22
Sat, Feb
64 New Articles
Date CoveredFirm(s)Deal/Litigation DescriptionValueCountry(ies)CEELM Coverage
Jun-16Wolf TheissWolf Theiss advised joint lead managers Banca IMI, Citi Bank, JP Morgan, and Raiffeisen Bank International on the Republic of Albania's EUR 650 million seven-year international bond issuance.EUR650millionAlbaniaHere
11-DecBird & Bird; Clifford Chance; Karanovic & PartnersClifford Chance advised the Aricoma Group on the acquisition of the Seavus technology company. Karanovic & Partners advised Aricoma on Serbia, Bosnia and Herzegovina, and Albanian elements of the deal. Seavus was advised by Bird & Bird's Stockholm office.N/AAlbania; Bosnia and Herzegovina; Czech Republic; SerbiaHere
2-JanBinder Grosswang; CMS; Frotz Riedl; SchoenherrBinder Groesswang and Schoenherr have advised Austria's Wiesenthal AG and Wiesenthal Holding on the sale of Wiesenthal & Co GmbH, including Wiesenthal Handel und Service GmbH, to Switzerland's Mercedes Benz Automobil AG. Switzerland's Frotz Riedl law firm and CMS Vienna advised the buyers on the transaction, which is expected to close in June 2020.N/AAustriaHere
2-JanDorda; SchoenherrDorda advised DLH Real Estate Austria, a company owned by the Zech Group, on the sale of two logistics properties and the forward sale of two additional logistics properties to Germany's Deka Immobilien. The buyers were advised by Schoenherr.N/AAustriaHere
3-JanDorda; SchoenherrDorda advised Patrizia AG on the sale of Zentrum Rennweg to Swiss Life Living + Working via a structured bidding process. Schoenherr advised Swiss Life Living + Working.EUR52millionAustriaHere
15-JanGarger Spallinger; Garrigues; Wolf TheissWolf Theiss and Garrigues advised the shareholders of Tag Systems S.A. on the sale of the company to Austriacard and their entrance into a joint venture with Austriacard. The buyers were advised by Garger Spallinger.N/AAustriaHere
15-JanDorda; SchoenherrSchoenherr advised Noella GmbH, an Austria-based company engaged in manufacturing and distribution of clothes for children, on its acquisition by Michael Pachleitner Group GmbH. Dorda advised the buyers.N/AAustria
17-JanLattenmayer, Luks & Enzinger; Wolf TheissWolf Theiss advised the REWE group on the sale of a property in the Donaustadt district of Vienna. The successful bidder, BUWOG, was advised by Lattenmayer Luks & Enzinger.N/AAustriaHere
17-JanBrandl & TalosBrandl & Talos supported APEX Ventures in the creation of the APEX Digital Health venture capital fund, designed for investments in new companies with unique technologies and applications in the healthcare sector.N/AAustriaHere
20-JanFellner Wratzfeld & PartnerFellner Wratzfeld & Partner advised Bundesimmobiliengesellschaft on the structuring and procurement of an "innovation partnership'' in Austria.N/AAustriaHere
22-JanBrandl & Talos; Herbst Kinsky; Schnittker MollmannBrandl & Talos advised Anyline on its generation of USD 12 million in growth capital through a Series A round of financing. Lead investors Project A and Senovo were advised by Herbst Kinsky and Schnittker Mollmann Partners, respectively.USD12millionAustriaHere
23-JanCMS; KPMG Legal; SchoenherrKPMG Law advised the shareholders of Barracuda Holding GmbH on the sale of 71% of the shares in the company to the CTS Eventim Group. The buyers were advised by CMS and Schoenherr.N/AAustriaHere
24-JanCMS; SchoenherrCMS advised Encavis Infrastructure Fund III on its acquisition of the Furstkogel wind farm in Austria, consisting of five wind turbines with a total rated output of 17.25 MW. The sellers, wind energy specialist Ecowind Handels- & Wartungs-GmbH, were advised by Schonherr.N/AAustriaHere
27-JanDSC Doralt Seist Csoklich; Linklaters; Wolf TheissWolf Theiss and Linklaters advised J.P. Morgan and Erste Group Bank AG as joint book-runners on S Immo AG's issuance of 6,691,717 new shares via an accelerated book-building procedure involving the exclusion of shareholders' subscription rights. S Immo AG was advised by DSC Doralt Seist Csoklich.N/AAustriaHere
27-JanFellner Wratzfeld & PartnerFellner Wratzfeld & Partner advised Bundesimmobiliengesellschaft m.b.H. on the structuring and procurement of an "innovation partnership" with several enterprises in Austria.N/AAustriaHere
28-JanHerbst Kinsky; Weber & Co.Weber & Co. advised Erste Group Bank AG as the sole bookrunner on the sale of 105,000 Marinomed Biotech AG shares by shareholders Acropora Beteiligungs GmbH, VETWIDI Forschungsholding GmbH, and BVT Beteiligungsverwaltung und Treuhand GmbH. Herbst Kinsky advised Marinomed on the sale.EUR10millionAustriaHere
28-JanWeber & Co.; Wolf TheissWeber & Co. advised DekaBank Deutsche Girozentrale, DZ Bank, Erste Group, RBI, and UniCredit as joint lead managers on the successful issuance of mortgage covered bank bonds by Raiffeisenlandesbank Oberosterreich AG. Wolf Theiss advised Raiffeisenlandesbank Oberosterreich on the issuance.EUR500MillionAustriaHere
29-JanSchoenherrSchoenherr helped UniCredit Bank establish its Social Impact Banking initiative in Austria.N/AAustriaHere
31-JanLinklaters; Rautner Attorneys At Law; Weber & Co.; Wolf TheissWolf Theiss advised Erste Group Bank AG on the issue of EUR 500 million of Additional Tier 1 Notes and on the issue of EUR 750 million Mortgage Pfandbriefe. Linklaters and Rautner Rechtsanwalte advised lead managers HSBS, BofA Securities, Morgan Stanley, and Societe Generale on the Tier 1 note issuance. Weber & Co advised Banca IMI, Danske Bank, DekaBank, DZ BANK, Erste Group (in its capacity as Manager), and LBBW on the Mortgage Pfandbriefe.1.2billionAustriaHere
31-JanWhite & Case; Wolf TheissWolf Theiss and White & Case advised joint lead managers ABN Amro, Deutsche Bank, DZ Bank AG, RBI, and UniCredit on UniCredit Bank Austria AG's successful January 21, 2020 placement of a benchmark EUR 500 million issuance of mortgage securities.EUR500millionAustriaHere
31-JanBc& Studio Di Consulenza Societaria Tributaria Legale; Brandl & TalosBrandl & Talos advised founders Simon Falkensteiner and Matthias Trenkwalder and investors including aws Gruenderfonds, Falkensteiner Ventures, and Nextfloor Ventures on the sale of RateBoard, a developer of a revenue management software for the hotel industry, to Zucchetti, an Italian software developer in the field of hospitality and restaurant industry. Zuchetti was advised by BC& Studio di Consulenza Societaria Tributaria Legale and Solo Practitioner Mario Perl.N/AAustriaHere
7-FebBrandl & Talos; Leitner LawBrandl & Talos advised Aws Mittelstandsfonds on an unspecified investment in Communi5 Technologies GmbH. Leitner Law advised Communi5 on the deal.N/AAustriaHere
13-FebWolf TheissWolf Theiss advised Raiffeisen Bank International AG on the issuance of Ordinary Senior Eligible bonds worth EUR 750 million under its EUR 25 million Debt Issuance Program. Banco Santander, S.A., BNP Paribas, Citigroup Global Markets Limited, Morgan Stanley & Co International, and RBI were joint lead managers.EUR750millionAustriaHere
24-FebAllen & OveryAllen & Overy advised Oesterreichische Kontrollbank on legal aspects of its public offering of USD 1.5 billion of 1.500% Guaranteed Global Notes due 2025.USD1.5billionAustriaHere
25-FebCMS; Herbst KinskyCMS Austria advised Topinstallateur GmbH on the acquisiton of a majority stake in the company by Germany's Auctus investment fund. Auctus was advised by Herbst Kinsky.N/AAustriaHere
25-FebCerha HempelCerha Hempel advised KTM AG on its establishment of a joint venture with Spanish engine manufacturer GasGas Motorcycles S.L.N/AAustriaHere
4-MarBrandl & Talos; Herbst Kinsky; SchoenherrBrandl & Talos advised Ready2order on its EUR 5 million investment round, which was led by Reimann Investors and Speedinvest, which were advised by Schoenherr and Herbst Kinsky.EUR5millionAustriaHere
11-MarDordaDorda advised China's Weichai Group on its acquisition of 51% of the VDS Group, an Upper-Austrian transmissions specialist. SCWP Schindhelm advised the sunidentified sellers on the deal.N/AAustriaHere
11-MarDordaDorda advised GalCap on the acquisition of a mixed-use building at Pohlgasee 26 in Vienna-Meidling from UBM and Invester. UBM was advised by solo practitioner Jakob Molzbichler.N/AAustriaHere
11-MarSchoenherrSchoenherr advised Austria's HS Timber Group and Blue Minds IF on their February 28, 2020 acquisition of Interfloat Corporation and GMB Glasmanufaktur Brandenburg GmbH.N/AAustriaHere
12-MarBrandl & Talos; Gross Hofer; Schnittker Moellmann Partners; Willkie Farr & GallagherBrandl & Talos, Willkie Farr & Gallagher, and Germany's Schnittker Moellmann Partners advised Insight Partners and e.ventures on the EUR 30 million series A investment in Viennese start-up PlanRadar. Grohs Hofer advised PlanRadar.EUR30millionAustriaHere
12-MarCleary Gottlieb Steen & Hamilton; SchoenherrSchoenherr and Cleary Gottlieb advised Google LLC on the acquisition of Looker Data Sciences.N/AAustria
13-MarHochedlinger Luschin Marenzi Kapsch; SchoenherrSchoenherr advised Neuraxpharm, a portfolio company of Apax Partners, on the acquisition of Austrian consumer healthcare company Easypharm OTC GmbH. Hochedlinger Luschin Marenzi Kapsch advised the unidentified sellers on the deal.N/AAustriaHere
16-MarDLA PiperDLA Piper advised PORR AG on the issuance of EUR 150 million hybrid bond.EUR150millionAustriaHere
16-MarCerha Hempel; LinklatersCerha Hempel advised CA Immobilien Anlagen AG on its EUR 500 million benchmark bond issuance. Linklaters advised sole global coordinator J.P. Morgan and joint book-runners Erste Group, J.P. Morgan, and Morgan Stanley.EUR500millionAustriaHere
17-MarAct Legal (WMWP); Herbst KinskyHerbst Kinsky advised Earlybird Venture Capital on its investment into Mostly AI Solutions MP GmbH. Act Legal advised Mostly AI.N/AAustriaHere
23-MarBinder Groesswang; SchoenherrBinder Groesswang advised Austrian risk and insurance manager GrECo and its majority owners, the Neubrand family, on the buy-back of GrECo shares from former partner JLT. Schoenherr advised the sellers on the deal.N/AAustriaHere
24-MarBPV Huegel; Dechert; DordaDechert and BPV Huegel advised Valneva Austria GmbH on debt financing it received from the US-based Deerfield and OrbiMed healthcare funds. Dorda advised the lenders.USD85millionAustriaHere
27-MarDorda; Reidlinger SchatzmannDorda advised Warburg-HIHInvest Real Estate on the sale of a multi-story office building in the Summering part of Vienna to a real estate fund managed by Luxembourg-based Blue Colibri Capital. Reidlinger Schatzmann advised the buyers.N/AAustriaHere
3-AprFellner Wratzfeld & PartnerFellner Wratzfeld & Partner advised VTB Bank Europe on financing provided to an unidentified buyer for its acquisition of 50% of SEMA Vermoegensverwaltung GmbH, the Austrian holding company of the Planquadr.at development and real estate portfolio group.N/AAustriaHere
7-AprDorda; Herbst KinskyDorda advised joint global coordinators UBS and HSBC on the EUR 1.65 billion capital increase of Austria's AMS AG.EUR1.65billionAustriaHere
7-AprDordaDorda advised Lernsieg Mobile Media GmbH on data protection issues related to the relaunch of its Lernsieg app, which allows students to evaluate their schools and teachers.N/AAustriaHere
9-AprWeber & Co.; White & CaseWeber & Co. advised OMV AG on the issuance of multi-tranche corporate bonds. White & Case Frankfurt advised joint lead managers Barclays Bank Ireland PLC, Credit Agricole Corporate and Investment Bank, MUFG Securities, Societe Generale, and UniCredit Bank Austria AG.EUR1.75billionAustriaHere
14-AprAllen & Overy; Dorda; Eisenberger & HerzogDorda advised Greiner AG on the takeover of Eurofoam GmbH from Recticel. The Brussels office of Allen & Overy and Eisenberger & Herzog advised Recticel on the deal.N/AAustriaHere
15-AprWolf TheissWolf Theiss advised Japan's Takeda Pharmaceuticals on its acquisition of Plasmaspendedienst GmbH.N/AAustriaHere
15-AprCerha HempelCerha Hempel advised Philip Morris Austria GmbH on the launch of a new tobacco product in Austria.N/AAustriaHere
15-AprDordaDorda successfully represented Willhaben in a dispute against AutoScout24 AS involving the Austrian Unfair Competition Act.N/AAustriaHere
15-AprCerha HempelCerha Hempel advised Philip Morris Austria on the launch of a new tobacco product in Austria.N/AAustriaHere
15-AprDordaDorda successfully represented Willhaben in a dispute with AutoScout24 AS.N/AAustriaHere
15-AprWolf TheissWolf Theiss advised Japan's Takeda Pharmaceuticals on its acquisition of Plasmaspendedienst GmbH.N/AAustriaHere
17-AprAllen & Overy; Binder Groesswang; Cerha Hempel; Eisenberger & Herzog; SchoenherrCerha Hempel and Schoenherr advised OMV on the acquisition of a 39% stake in Borealis AG from Mubadala for USD 4.68 billion. Allen & Overy, Eisenberger & Herzog, and Binder Groesswang advised Mubadala on the transaction.USD4.68billionAustriaHere
22-AprBaker MckenzieBaker McKenzie advised McDonald's on the implementation of short-time work for all of its restaurants in Austria due to the Coronavirus pandemic.N/AAustriaHere
27-AprBinder GroesswangBinder Groesswang advised Lenzing AG and Palmers Textil AG on the establishment of a joint venture to produce protective masks in Austria.N/AAustriaHere
29-AprBinder GroesswangBinder Groesswang helped Austrian Post with the launch of its new bank - Bank99.N/AAustriaHere
30-AprDLA PiperDLA Piper Austria advised FFF Real Estate, a subsidiary of FFF Fund I SCSp SICAV-RAIF, on financing provided to an unnamed residential real estate developer for the acquisition and development of an unspecified residential project in Luxembourg.N/AAustriaHere
30-AprCerha Hempel; SchoenherrCerha Hempel advised the shareholders of Austrian electric motor manufacturer ELIN Motoren GmbH on the sale of a 70% stake in the company to the Voith technology group. Schoenherr advised the buyers.N/AAustria
4-MayBinder Groesswang; Freimuller Obereder PilzBinder Groesswang and Freimuller Obereder Pilz advised on Sapphire Ventures' participation in Adverity's EUR 23 million Series C financing round. Adverity was advised by Freimuller Obereder Pilz.EUR23millionAustriaHere
7-MayPHH RechtsanwaltePHH helped GR Real acquire the historic Art Nouveau apartment building in Linz.N/AAustriaHere
8-MayCerha Hempel; Fellner Wratzfeld & Partner; SchoenherrSchoenherr advised Voith and Fellner Wratzfeld & Partner advised PCS on their acquisition of 59% of the shares of Traktionssysteme Austria GmbH. Cerha Hempel advised the selling shareholders on the deal.N/AAustriaHere
8-MayWolf TheissWolf Theiss assisted Swiss investment foundation AFIAA on the sale of a six-property office and retail property portfolio in Salzburg to German property developer RMI.N/AAustriaHere
22-MayBPV Huegel; Lenz & Staehelin; Simpson Thacher & BartlettBPV Huegel, working alongside Switzerland's Lenz & Staehelin law firm, advised Raiffeisen Informatik on the sale of shares in SoftwareONE Holding AG via an over-night accelerated book-building process. Credit Suisse AG, J.P. Morgan Securities plc, UBS AG, and KKR Capital Markets Partners LLP acted as joint book-runners for the placement. Simpson Thacher & Bartlett advised KKR on the deal.CHF350millionAustriaHere
22-MayDorda; Eisenberger & Herzog; GSK Stockmann; Hogan LovellsDorda and Hogan Lovells advised ARE Austrian Real Estate on a joint project with UBM Development involving the development of part of the Aspanggrunde in Vienna's 3rd district and an area in Munich. UBM was advised by Eisenberger & Herzog and GSK Stockmann.N/AAustriaHere
22-MaySchoenherr; Wolf TheissSchoenherr advised Invester United Benefits on the sale of the Wohngarten residential construction project in Vienna to ZBI Zentral Boden Immobilien Gruppe. Wolf Theiss advised the buyers on the deal.N/AAustriaHere
27-MayDeloitte Legal; Lumsden and PartnersDeloitte Legal advised Magenta Telekom on structuring its cooperation with the City of Vienna regarding broadband coverage. Lumsden and Partners advised the City of Vienna on the deal.EUR1billionAustriaHere
28-MayBrandl & Talos; Covington & Burling; Herbst Kinsky; Mcdermott Will & Emery; Wilson Sonsini Goodrich & Rosati; Wolf TheissWolf Theiss and Covington & Burling advised MSD on its acquisition of Austrian biotech company Themis Bioscience. Brandl & Talos and Wilson Sonsini Goodrich & Rosati advised the selling shareholders on the deal, with McDermott Will & Emery and Herbst Kinsky advising Themis Bioscience.N/AAustriaHere
9-JunAllen & Overy; BPV Huegel; Dorda; Rittershaus; Siwa Rechtsanwalte Szinger & PartnerBPV Huegel, working with SIWE Rechtsanwalte Sinzger & Partner, advised Dogado GmbH - a subsidiary of European Directories - on its acquisition of Austrian hosting provider Easyname GmbH. Dorda and Rittershaus advised the seller, Easyname's Founder and Managing Director Florian Schicker, and Allen & Overy's Frankfurt office advised European Directories.N/AAustriaHere
9-JunTaylor Wessing; Wolf TheissTaylor Wessing advised the Korber Group and subsidiary Werum IT Solutions GmbH on their acquisition of the operations of Exputec GmbH and Exputec Kft. Wolf Theiss advised Exputec on the deal.N/AAustriaHere
10-JunCerha Hempel; PreslmayrCerha Hempel, working alongside German law firm Menold Benzler, advised Alfred Ritter GmbH & Co KG on its acquisition of a production facility belonging to Mars Austria OG in the Austrian village of Breitenbrunn. Preslmayr advised Mars.N/AAustriaHere
11-JunWeber & Co.; Wolf TheissWeber & Co advised Wienerberger AG, a Vienna-based supplier of building materials and infrastructure solutions, on its issuance of EUR 400 million of 2.750% 2020-2025 Bonds. Wolf Theiss advised joint lead managers BNP Paribas, Raiffeisen Bank International AG, and UniCredit on the issuance.EUR400millionAustriaHere
11-JunFellner Wratzfeld & PartnerFellner Wratzfeld & Partners supported the biodiversity project known as "Mielo" and donated a large amount of the honey produced through the project to the parish of St. Stephen's Cathedral in Vienna.N/AAustriaHere
18-JunCerha Hempel; Wolf TheissWolf Theiss advised Euronext Amsterdam-listed Royal DSM on its acquisition of the Erber Group. Cerha Hempel advised San Pacific Investment and San Venture Biotech, as well as their sole shareholder Erich Erber, on the sale of Erber to Royal DSM.EUR1.06billionAustriaHere
24-JunWeber & Co.; White & CaseWeber & Co advised OMV AG, the international integrated oil and gas company headquartered in Vienna, on the issuance of two tranches of corporate bonds. White & Case's Frankfurt office advised joint lead managers Citigroup Global Markets Europe AG, Commerzbank Aktiengesellschaft, Erste Group Bank AG, Landesbank Baden-Wuerttemberg, Mizuho Securities Europe GmbH, and Raiffeisen Bank International AG.EUR1.5billionAustriaHere
26-JunDordaDorda advised Eastern Property Holdings on the acquisition of an office building in Vienna.N/AAustriaHere
26-JunBPV HuegelBPV Huegel helped Austrian low-cost airline Level Europe GmbH initiate and implement judicial insolvency proceedings at the Regional Court of Korneuburg.N/AAustriaHere
30-JunSchoenherrSchoenherr advised a club of lenders led by Erste Group and including Raiffeisen Bank International, UniCredit Bank Austria, BAWAG, and Oberbank on a EUR 300 million financing for Austrian Airlines.EUR300millionAustriaHere
30-JunEisenberger & HerzogEisenberger & Herzog helped OBB-Technische Services GmbH, LTE Logistik Transport-GmbH, and ELL Austria GmbH set up a joint venture to establish and operate a service base for locomotives.N/AAustriaHere
1-JulMilbank; Morgan Lewis & Bockius; Paul, Weiss, Rifkind, Wharton & Garrison; SchoenherrSchoenherr, Milbank, and Paul Weiss advised NuCom Group, a joint venture of ProSiebenSat.1 and General Atlantic, on its acquisition of The Meet Group, Inc. Morgan Lewis advised the sellers.EUR451millionAustria
1-JulSchoenherr; Schrebaum SeebacherSchonherr advised Union Investment on the acquisition of a residential complex in Graz from the Immola Group. Scherbaum Seebacher advised the Immola Group on the deal.N/AAustriaHere
2-JulBPV Huegel; Kung Rechtsanwalte & Notare; Lenz & Staehelin; Simpson Thacher & BartlettBPV Huegel advised Raiffeisen Informatik on the sale of shares in SoftwareONE Holding by KKR, Raiffeisen Informatik, and the heirs of Patrick Winterin, via an accelerated book-building process. Lenz & Staehelin acted as Swiss counsel for the sellers, KKR was advised by Simpson Thacher & Bartlett, and the heirs of Patrick Winter were advised by Switzerland's Kung Rechtsanwalte & Notare firm.CHF380millionAustriaHere
2-JulHerbst KinskyHerbst Kinsky advised Viennese start-up GoStudent GmbH on its EUR 8.3 million series A financing round, which was led by VC fund Left Lane Capital.EUR8.3millionAustriaHere
3-Jul42Law; Cerha Hempel; Deloitte LegalCerha Hempel, working alongside Deloitte Legal in Germany, advised Germany's GBTEC Software + Consulting AG on the acquisition of all shares in Avedos, a Vienna-based GRC software specialist, through direct and indirect share purchases and by means of a contribution by Samuel Brandstatter - the founder, managing director and shareholder of Avedos. 42law advised Brandstatter on the deal.N/AAustriaHere
13-JulBinder Groesswang; Clifford ChanceBinder Groesswang and Clifford Chance Frankfurt advised BNP Paribas' Arval subsidiary on the acquisition of UniCredit Leasing Fuhrparkmanagement GmbH and a long-term cooperation agreement with UniCredit Bank Austria.N/AAustriaHere
14-JulSchoenherrSchoenherr successfully represented TIWAG-Tiroler Wasserkraft AG before Austria's Administrative Court in the last challenge to the implementation of the Kuhtai Storage Power Plant project.N/AAustriaHere
15-JulEisenberger & Herzog; Peters, Schonberger & PartnerEisenberger & Herzog, working alongside Germany's Peters, Schonberger & Partner, advised Vetter Pharma on its acquisition of a clinical production facility in Rankweil, Austria.N/AAustriaHere
16-JulEisenberger & HerzogEisenberger & Herzog advised the Switzerland's Brisen Group on its entrance into an operating agreement with the Mandarin Oriental hotel chain.EUR100millionAustriaHere
17-JulBPV Huegel; Linklaters; Weber & Co.BPV Huegel advised Immofinanz on a combined share placement and the first-to-market issue of subordinated mandatory convertible notes. Linklaters and Weber & Co. advised bookrunners J.P. Morgan Securities plc, Sole Global Coordinator, and Erste Group Bank AG and Raiffeisen Centrobank AG.N/AAustriaHere
20-JulEisenberger & HerzogEisenberger & Herzog helped Austrian Airlines on its receipt of State aid amounting to EUR 150 million from the Republic of Austria.EUR150millionAustriaHere
22-JulFreshfields; SchoenherrFreshfields Bruckhaus Deringer advised an international banking consortium consisting of HSBC Bank plc, JP Morgan Securities plc, and Raiffeisen Bank International AG on Uniqua Insurance Group AG's successful issuance of two bonds worth a total of EUR 800 million. Schoenherr advised Uniqua on the deal.EUR800millionAustriaHere
22-JulDLA PiperDLA Piper advised Austria's Kurant GmbH on the Europe-wide roll-out of its Bitcoin vending machines.N/AAustriaHere
24-JulBinder Grosswang; BPV Huegel; Herbert Smith FreehillsBPV Huegel worked with the Frankfurt office of Herbert Smith Freehills in advising the Heidelpay Group, a German technology company for international payments, on the acquisition of the Paysafe Group's Pay Later business. Binder Groesswang advised the Paysafe group.N/AAustriaHere
30-JulThemmer Toth & Partner; Weber & Co.Weber & Co. advised Central European University on its July 27, 2020 agreement with the Vienna Business Agency to use the Otto Wagner site in Vienna as the university's new site. Themmer, Toth & Partner advised the Vienna Business Agency.N/AAustriaHere
31-JulSchoenherrSchoenherr assisted Auer-Blaschke GmbH & Co KG with the registration of its new AUER brand design as a model brand at the Austrian Patent Office.N/AAustriaHere
5-AugEisenberger & Herzog; Schnittker Moellmann PartnersEisenberger & Herzog advised Samsung Catalyst Fund, a venture capital fund of Samsung Electronics Co., Ltd, on an undisclosed investment in the Speedinvest 3 fund, which was advised by Berlin-based Schnittker Mollmann Partners.N/AAustriaHere
7-AugHerbst KinskyHerbst Kinsky advised Byrd technologies GmbH on a EUR 5 million Series A financing round.EUR5millionAustriaHere
10-AugFreshfields; Linklaters; Wolf TheissWolf Theiss and Linklaters advised Raiffeisen Bank International AG on the issuance of EUR 500 million worth of additional Tier 1 capital. Freshfields Bruckhaus Deringer advised joint lead managers Barclays Bank plc, Goldman Sachs International, J.P. Morgan Securities plc, Raiffeisen Bank International AG, and UBS Europe SE.EUR500millionAustriaHere
11-AugBrandl & TalosBrandl & Talos advised BTOV's Industrial Technologies Fund on its participation in ToolSense's financing round that also included AWS Grunderfonds, Segnalita Ventures, Martin Global AG, and Dr. Georg Hoblik GmbH.EUR3millionAustriaHere
11-AugFellner Wratzfeld & PartnerFellner Wratzfeld & Partner advised a consortium of UniCredit Bank Austria, BAWAG P.S.K, Commerzbank, Raiffeisenlandesbank Oberoesterreich, and HYPO Vorarlberg on the reorganization proceedings of the Huber Group, an Austrian lingerie manufacturer.N/AAustriaHere
17-AugLinklaters; SchoenherrSchoenherr advised HETA Resolution AG on the sale of Julia Portfolio Solutions S.p.A., an Italy-based company engaged in the non-performing loan sector, to Bain Capital Credit, LP. Linklaters advised the buyers.N/AAustria
24-AugBaker Mckenzie; Freimuller Obereder PilzBaker McKenzie advised Amplifier Game Invest on the acquisition of games developer Rare Earth Games. The Freimueller, Obereder, Pilz firm advised Rare Earth Games founders Michael Borras, Peter Ehardt, and Helmut Hutterer.EUR300000AustriaHere
30-AugAllen & Overy; Cerha Hempel; Eisenberger & Herzog; SchoenherrCerha Hempel advised EnBW Trust e.V. and EnBW Energie Baden-Wurttemberg AG on the sale of a 28.35% stake in EVN AG that was held in trust for EnBW by the EnBW Trust. Allen & Overy and Eisenberger & Herzog advised the buyers. EVN was advised by Schoenherr.EUR1billionAustria
31-AugRautner Attorneys at LawRautner Rechtsanwalte advised Windkraft Simonsfeld on a EUR 63 million financing deal with the European Investment Bank and Erste Bank.EUR63millionAustriaHere
2-SepHerbst KinskyHerbst Kinsky advised Presono GmbH on a media-for-equity deal with Seven Ventures Austria.N/AAustriaHere
3-SepGassauer-Fleissner; PHH RechtsanwaltePHH advised Bondi Consult on the sale of the "service hub" part of the TwentyOne commercial project in Vienna's Floridsdorf district to InterXion. Gassauer-Fleissner Rechtsanwalte advised InterXion on the deal.N/AAustriaHere
4-SepEY Law; SchoenherrSchoenherr advised Art-Invest Real Estate on the acquisition of the Q11 - Leben am Fluss residential property in Sankt Polten, Lower Austria. EY Law advised the seller.N/AAustria
7-SepWeber & Co.; White & Case; Wolf TheissWhite & Case and Wolf Theiss advised joint lead managers Barclays, MUFG, UniCredit Bank Austria, BNP Paribas, Credit Agricole CIB, J.P. Morgan, Societe Generale Corporate & Investment Banking, Bayern LB, DZ Bank AG, Helaba and SMBC Nikko on OMV Aktiengesellschaft's EUR 1.25 billion hybrid bonds issue. Weber & Co advised the issuer on the deal.EUR1.25billionAustriaHere
15-SepBinder Groesswang; Bird & BirdBinder Groesswang and Bird & Bird advised Blockpit on its acquisition of 21 Consulting.N/AAustriaHere
21-SepBinder GroesswangBinder Groesswang advised Austrian cryptocurrency service provider SmartBytes GmbH, operating as Coinpanion, on a pre-seed financing round.N/AAustriaHere
22-SepDorda; Eisenberger & HerzogDorda advised Patrizia AG on the acquisition of the Aira Tower residential project in Graz from Aira Development Group. Eisenberger & Herzog advised the Aira Development Group on the sale.N/AAustriaHere
2-OctSchoenherrSchoenherr advised Austrian fintech Bitpanda on a European Series A financing round that was led by Valar Ventures. Taylor Wessing advised Valar Ventures.USD52millionAustriaHere
6-OctCerha Hempel; SchoenherrCerha Hempel advised OMV on the sale of its 51% stake in Gas Connect Austria GmbH to Verbund AG. Schoenherr advised Verbund on the sale.EUR271millionAustriaHere
9-OctDelphi; Schoenherr; SCWP SchindhelmSchoenherr and Sweden's Delphi law firm advised AddLife on its acquisition of all shares in the DACH Medical Group Holding AG. The unidentified sellers were advised by SCWP Schindhelm.N/AAustriaHere
12-OctDe Breij Boon Evers; Fasken Martineau Dumoulin; K.Treppides & Co; McMillan; Schoenherr; StibbeSchoenherr, McMillan, De Breij Boon Evers, and K.Treppides & Co advised Smart2Pay Global Services B.V. on its sale to the Nuvei Corporation. Stibbe and Fasken Martineau Dumoulin advised the buyer.EUR221.57millionAustria
15-OctBinder Groesswang; Bird & BirdBinder Groesswang, working alongside lead counsel Bird & Bird, advised European investment fund Cube Infrastructure Fund II on the acquisition of a majority stake in Switzerland's Heliot Group.N/AAustriaHere
16-OctBinder Groesswang; Grama Schwaighofer Vondrak RechtsanwalteBinder Groesswang advised UBM Development on the sale of its housing project in Vienna's Nordbahnviertel district to the Buwog Group. Grama Schwaighofer Vondrak advised Buwog on the deal.EUR50millionAustriaHere
16-OctCMSCMS Austria advised Oesterreichische Nationalbank on the Felix Austria project, which seeks to modernize the processing of bulk payment transactions in Austria.N/AAustriaHere
16-OctBinder Groesswang; DLA PiperBinder Groesswang advised Lafayette Mittelstand Capital on its acquisition of the elevator cable business from the Gebauer & Griller Group as part of a carve-out. DLA Piper advised Gebauer & Griller on the deal.N/AAustriaHere
19-OctCMSCMS advised Bechtle AG on its acquisition of Dataformers GmbH.N/AAustriaHere
20-OctAshurst; Bredin Prat; Dr. Beck & Partner; Taylor Wessing; SchoenherrSchoenherr, Ashurst, and Dr. Beck & Partner advised Schlemmer GmbH on its acquisition by Delfingen Industry. S.A. Bredin Prat and Taylor Wessing advised the buyer.N/AAustria
22-OctBinder Groesswang; Garrigues; Willkie Farr & Gallagher; Wolf TheissBinder Groesswang and Willkie Farr & Gallagher have advised private equity investment company Ardian on the sale of Gantner Electronic Austria Holding GmbH to Salto Systems. Wolf Theiss and Garrigues advised Salto Systems.N/AAustriaHere
23-OctBPV Huegel; Lenz & StaehelinBPV Huegel and Lenz & Staehelin have advised Raiffeisen Informatik on the sale of the remaining shares in SoftwareONE Holding in an accelerated book-building process.CHF111millionAustriaHere
27-OctCMSCMS advised green electricity provider eFriends on the sale of a 24% stake to RWA Raiffeisen Ware Austria.N/AAustriaHere
28-OctAllen & Overy; Eisenberger & Herzog; Freshfields; Shearman & SterlingEisenberger & Herzog, Allen & Overy, and Shearman & Sterling advised SAP SE on iyd acquisition of Emarsys, a Viennese cloud-based provider of omnichannel customer loyalty platforms. Freshfields Bruckhaus Deringer advised Emarsys.N/AAustriaHere
28-OctFellner Wratzfeld & PartnerFellner Wratzfeld & Partner advised Immobilien Holding on the sale of its shares in Arwag Holding to the Fund for Temporary Housing in Vienna.N/AAustriaHere
29-OctBinder Groesswang; Brandl & Talos; Hengeler Mueller; Schif HardinBinder Groesswang, Schiff Hardin, and Hengeler Mueller advised California-based medical devices and life science instruments manufacturer Paramit Corporation on the acquisition of Austria's System Industrie Electronic GmbH and its German subsidiary, System Industrie Electronic Deutschland GmbH, from former majority shareholder System Industrie Holding AG (and its ultimate owner, the Filzmaier Private Foundation) and Aws Mittelstandsfonds, a former minority shareholder. Brandl & Talos advised the sellers on the transaction.N/AAustriaHere
30-OctAct Legal (WMWP); SchoenherrSchoenherr advised Austrian start-up Carbomed Medical Solutions on a EUR 3 million financing round led by AWS Gruenderfonds. Act Legal Austria WMWP advised AWS Gruenderfonds on the deal.EUR3millionAustriaHere
30-Oct42Law; Eisenberger & HerzogEisenberger & Herzog advised Markus Kummel, Oliver Jusinger, and Andreas Kossmeier, the founders of the Bergfex tourism platform, on the sale of a 60% stake to Russmedia Equity Partners. 42law advised Russmedia Equity Partners on the deal.N/AAustriaHere
2-NovCleary Gottlieb Steen & Hamilton, Hengeler Mueller; Linklaters; Milbank; SchoenherrSchoenherr, Milbank, and Linklaters advised The Carlyle Group on its acquisition of Flender, a Germany-based specialist in mechanical and electrical drive technology, from Siemens. Cleary Gottlieb and Hengeler Mueller advised the buyer.EUR2billionAustria
2-NovBahr; Brandl & Talos; Bruun & Hjejle; Cirio; Wikborg | ReinBrandl & Talos advised Ring International Holding on its takeover of the Burger King franchise in Norway, Sweden, and Denmark from Umoe Restaurants. Norwegian law firm Bahr advised the seller on the deal. Wikborg | Rein in Norway, Cirio in Sweden, and Bruun & Hjejle in Denmark acted as local advisors to the buyer.N/AAustriaHere
3-NovCerha Hempel; LinklatersCerha Hempel advised Immofinanz on its successful placement of an unsubordinated, unsecured bonds issue worth EUR 500 million. Citigroup and J.P. Morgan Securities acted as joint global coordinators and joint bookrunners, while Credit Suisse, Deutsche Bank, Erste Group Bank, and HSBC served as joint bookrunners on the deal. Linklaters advised the underwriters.EUR500millionAustriaHere
3-NovArnold Rechtsanwalte; DordaDorda advised Ascott on an agreement for serviced residences in the Forum Donaustadt/Vienna Twentytwo development in Vienna with Signa Real Estate and Austria Real Estate. The aparthotel will be marketed under the Citadines Apart'hotel brand and is scheduled to open at the end of 2022. Arnold advised Signa and ARE on the deal.N/AAustriaHere
4-NovSchoenherrSchoenherr successfully represented Austrian AOP Orphan Pharmaceuticals AG in arbitration against Taiwan's PharmaEssentia Corporation.N/AAustriaHere
4-NovSchoenherr; Wolf TheissSchoenherr and Wolf Theiss advised Innio Jenbacher GmbH & Co OG on the acquisition of ECI-Distribution GmbH and its service partner PowerUp GmbH.N/AAustria
5-NovDordaDorda successfully defended Energy Hero in a case heard by the Austrian Supreme Court against an unspecified energy supplier.N/AAustriaHere
6-NovCMS; KPMG LegalCMS advised Plastic Omnium on establishing a joint venture with ElringKlinger. In addition, Plastic Omnium acquired ElringKlinger's_Austrian subsidiary, ElringKlinger_Fuelcell_Systems Austria. KPMG Law advised ElringKlinger.EUR15millionAustriaHere
11-NovCerha Hempel; LinklatersCerha Hempel advised CA Immobilien Anlagen on its EUR 350 million placement of a fixed rate senior unsecured green bond. Linklaters advised joint global coordinators J.P. Morgan Securities plc and Morgan Stanley & Co International plc and joint bookrunners and joint sustainability structuring agents UniCredit Bank AG and Raiffeisen Bank International AG.EUR350millionAustriaHere
13-NovBinder GroesswangBinder Groesswang advised the SeneCura Group on its acquisition of Austria's St. Veit/Glan therapy center.N/AAustriaHere
17-NovBrandl & Talos; TBS SchmidtBrandl & Talos advised AWS Grunderfonds on its EUR 1.8 million seed investment in Vienna-based real estate startup Rendity. TBS Schmidt reportedly advised Rendity on the deal.EUR1.8millionAustriaHere
23-NovHerbst KinskyHerbst Kinsky helped Austrian start-up Trality attract EUR 1.5 million in financing from a group of German investors including Blockrocket, VC Tokentus, FFG, and AWS.EUR1.5millionAustriaHere
23-NovGraf & PitkowitzGraf & Pitkowitz advised Germany's Cherry GmbH on the acquisition of Austria's Theobroma Systems Design and Consulting GmbH.N/AAustriaHere
26-NovHerbst KinskyHerbst Kinsky advised investment company Round2Capital Partners GmbH & Co KG on its EUR 6.6 million financing round.EUR6.6millionAustriaHere
27-NovAGP Advokater; EY Law; SchoenherrSchoenherr advised Christian Bamberger, SK Capital GmbH, Foxyflo GmbH, Christian Waldheim, and Martin Mrvka on the sale of 100% of Austrian communication-platform-as-a-service companies ATMS, SMS.AT, and WebSMS to Norwegian Link Mobility Holding ASA. AGP Advokater and EY Law advised Link Mobiliy on the transaction.N/AAustriaHere
4-DecDordaDorda successfully represented Italian investor Francesco Becchetti in enforcement proceedings against the assets of the Republic of Albania in Austria.EUR25millionAustriaHere
7-DecLorenz & Strobl; SchoenherrSchoenherr advised Gebauer & Griller Kabelwerke GmbH on its acquisition by Konstant Industriebeteiligung GmbH. Lorenz & Strobl advised the buyer.N/AAustria
9-DecDordaDorda advised DLH Real Estate Austria on the sale of a 65,000-square-meter section of the Industrial Campus Vienna East to Deka Immobilien.N/AAustriaHere
11-DecDorda; PwC LegalDorda advised DLH Real Estate Austria on the acquisition of a 30,000-square-meter property in the Future Zone East industrial park from Vienna Airport Business Park and Airport Services VIE Immobilien. PwC Legal advised the sellers on the deal.N/AAustriaHere
14-DecClifford Chance; Linklaters; SchoenherrSchoenherr and Clifford Chance advised Hypo Vorarlberg on the synthetic securitization of a EUR 330 million portfolio of loans to small and medium-sized enterprises, corporate borrowers, or certain private individuals, which was provided by the European Investment Fund and European Investment Bank. Linklaters advised the EIF and EIB on the deal.EUR330millionAustriaHere
14-DecCMSCMS advised A1 Telekom Austria AG on the acquisition of Alcatel-Lucent Voice Business, the classic telephony business of technology service provider NTT Ltd.N/AAustriaHere
14-DecBinder Groesswang; SchoenherrBinder Groesswang advised OBB-Technische Services on the establishment of a joint venture with Voestalpine Stahl for the purpose of freight wagon production. Schoenherr advised the co-venturer on the deal. Gleiss Lutz reportedly acted as a local advisor in Germany to Voestalpine.N/AAustriaHere
15-DecCerha Hempel; Eisenberger & HerzogEisenberger & Herzog advised German real estate investment and asset manager Hamburg Trust on the acquisition of the newly constructed Siemensstrasse residential living project in Vienna from Eyemaxx Real Estate AG, advised by Cerha Hempel.N/AAustriaHere
15-DecHerbst KinskyHerbst Kinsky advised Biogena Group Invest on the initial public offering of its shares and their listing on the Vienna Stock Exchange.N/AAustriaHere
18-DecBinder Groesswang; Linklaters; Wolf TheissBinder Groesswang advised Lenzing AG on the successful issuance of a EUR 500 million hybrid bond. Linklaters and Wolf Theiss advised joint global coordinators BNP Paribas and Morgan Stanley and joint bookrunners BNP Paribas, Morgan Stanley, and UniCredit.EUR500millionAustriaHere
21-DecEisenberger & Herzog; OberhammerEisenberger & Herzog advised Krenhof AG on its merger with Pankl Racing Systems AG. Oberhammer advised Pankl Racing Systems on the merger.N/AAustriaHere
22-DecCMS; Wolf TheissCMS has advised joint lead managers BofA Securities, BNP Paribas, Erste Group, Goldman Sachs International, JP Morgan, and UBS on Erste Group Bank AG's EUR 750 million issuance of undated fixed-to-fixed resettable notes. Wolf Theiss advised the issuer on the deal.EUR750millionAustriaHere
22-DecCerha HempelCerha Hempel helped Germany's COSI Hospitality Group enter the Austrian hotel and apartment market.N/AAustriaHere
23-DecClifford Chance; Hogan Lovells; Latham & WatkinsCerha Hempel and Hogan Lovells advised OMV on the sale of its filling station business in Germany to Britain's EG Group. Latham & Watkins advised the EG Group on the deal.EUR485millionAustriaHere
23-DecEisenberger & Herzog; SchoenherrSchoenherr advised UBS Europe SE on the sale of its onshore wealth management business in Austria to LGT Bank AG.N/AAustriaHere
24-DecBrandl & Talos; SMPBrandl & Talos and SMP advised System Industrie Electronic Holding on the acquisition of a 70.1% stake in Elektromotorenwerk Grunhain.N/AAustriaHere
28-DecEisenberger & Herzog; Taylor WessingEisenberger & Herzog advised Wien Energie GmbH on the acquisition of a 49% stake in Austria's Pongratzer Kogel, Herrenstein, and Zagersdorf wind farms from wind and solar farm operator Encavis AG. Taylor Wessing advised Encavis on the deal.N/AAustriaHere
30-DecBuchberger Rechtsanwalts; SchoenherrSchoenherr advised Bilfinger Maschinenbau GmbH & Co KG on thesale of its mechanical and apparatus engineering business to ISW Heavy Components GmbH. Buchberger Rechtsanwalts advised the buyer.N/AAustria
1-AugKovacevic Prpic Simeunovic; Roedl & Partner; Waitz RechtsanwalteKPS, working with Roedl & Partner and Mazars Croatia, advised Tyssenkrupp on the Croatian aspects of a multijurisdictional corporate restructuring project, in particular on cross-border upstream merger of its Croatian subsidiary, along with four other EU-based entities, into a newly established EU-based holding company. Waitz Rechtsanwalte advised on Austrian law.N/AAustria, Croatia; Czech Republic; Hungary; Poland; Romania
1-SepAkin Gump; McCann FitzGerald; Schoenherr; Watson Farley & WilliamsSchoenherr, Akin Gump, and McCann FitzGerald advised Endava plc, a UK-based provider of information technology services, on the acquisition of Comtrade Digital Services Limited, an Ireland-based provider of strategic software engineering services and solutions, from Serbia's Comtrade Group B.V. Watson Farley & Williams advised the sellers.EUR60millionAustria; Bosnia and Herzegovina; Serbia; Slovenia
15-JunSchoenherrSchoenherr, acting as leader of a consortium of European law firms, conducted what it describes as "a comprehensive study on the regulatory and administrative requirements for entry and trade on the gas wholesale market in the EU for the European Commission, Directorate General Energy."N/AAustria; BulgariaHere
11-MarBopa Bojanovic Partners; Cerha Hempel; K&L Gates; Kavcic Bracun & Partners; Madirazza & Partners; Prelevic Law FirmCerha Hempel and K&L Gates advised the EBRD on the conversion of its indirect participation in listed Addiko Bank AG into a direct participation. Freshfields Austria served as local counsel to Advent International Corporation. Bopa Bojanovic Partners in Serbia, Kavcic Bracun & Partners in Slovenia, Madirazza & Partners in Croatia, and Prelevic Law firm of the Adriala network advised the EBRD in the CSEE region.EUR10.61billionAustria; Croatia; Montenegro; Serbia; SloveniaHere
11-MayBinder Groesswang; Havel & Partners; Jandura a PartneriBinder Groesswang and Havel & Partners advised BEXity and its holding company, Mutares SE & Co. KGaA, on the management buy-out of Czech subsidiary European Contract Logistics. The buyer, EC Logistics CEO Roman Goerojo, was advised by Jandura a Partneri.N/AAustria; Czech RepublicHere
24-JulMares & Partners; SchoenherrSchoenherr advised IB Interbilanz Wirtschaftsprufungs GmbH & Co. KG on the sale of the Czech Republic's Grant Thornton Audit s.r.o. and Grant Thornton Tax and Accounting s.r.o. to Grant Thornton Advisory s.r.o. Mares & Partners advised the buyer.N/AAustria; Czech Republic
18-NovBaker Mckenzie; Clifford Chance; Lenz & StaehelinClifford Chance and Switzerland's Lenz & Staehelin advised the KKCG AG investment company and the Sazka Group on the EUR 500 million investment into Sazka by funds managed by affiliates of Apollo Global Management. Baker McKenzie advised Apollo.EUR500millionAustria; Czech RepublicHere
27-FebBonelliErede; Gianni Origoni Grippo Cappelli; Ludovici Piccone And Partners; SchoenherrSchoenherr, in cooperation with BonelliErede, advised Covivio on its EUR 573 million acquisition of eight luxury hotels in Europe from alternative investment firm Varde Partners. Varde was reportedly advised by Italian firms Gianni Origoni Grippo Cappelli and Partners and Ludovici Piccone and Partners.EUR573millionAustria; Czech Republic; PolandHere
11-MarEisenberger & Herzog; NoerrNoerr and Eisenberger & Herzog advised Austrian packaging company Coveris on its acquisition of Plasztik-Tranzit Kft, a producer of flexible packaging solutions for the food industry. The unidentified sellers were advised by solo practitioner Tamas Reisz.N/AAustria; HungaryHere
30-SepDentonsDentons helped Austrian insurance group UNIQA and CherryHUB, its Hungarian InsurTech subsidiary, enter the German market.N/AAustria; HungaryHere
7-DecAllen & Overy; NautaDutilh; Paksoy; RTPR; Wolf TheissAllen & Overy and RTPR advised Dutch life insurance, pension, and asset management company Aegon on the EUR 830 million sale of its operations in Romania, Hungary, Poland, and Turkey to the Vienna Insurance Group. Wolf Theiss, Paksoy, and NautaDutilh advised the Vienna Insurance Group on the deal.EUR830millionAustria; Hungary; Poland; Romania; TurkeyHere
15-OctCMS; Wolf TheissCMS advised Green Source GmbH and its Solar Partners subsidiary on financing provided by Kommunalkredit Austria for the construction of power plants in Hungary. Wolf Theiss advised Kommunalkredit Austria.EUR66millionAustria; Hungary; SlovakiaHere
9-SepCMS; SchoenherrSchoenherr advised Twisto Finco PL SP z.o.o. on financing by new investors Orbit Capital SICAV, a.s. and Growth Finance s.r.o. CMS advised Orbit Capital.EUR4.1millionAustria; Poland
6-FebDentons; Kirkland & Ellis; NoerrDentons and Kirkland & Ellis represented GIC, Singapore's sovereign wealth fund, on the acquisition of the Maximus logistics real estate portfolio from funds managed by Apollo Global Management, a US-based private equity firm. Noerr advised the sellers on the transaction.EUR950millionAustria; Poland; SlovakiaHere
21-OctClifford Chance; Popovici Nitu Stoica & AsociatiiPNSA advised beneficiary CE Oltenia in arbitral proceedings under ICC Rules initiated by a general contractor concerning a public procurement contract for the design, delivery, construction, assembly, and commissioning of a joint plant for flue gas desulphurisation in Romania. Clifford Chance advised the claimants.N/AAustria; Romania
29-OctAlrudAlrud helped OMV AG and Borealis AG obtain antitrust and foreign investment clearances from FAS Russia for OMV's acquision of a 75% stake in Borealis.USD4.68billionAustria; Russia
28-DecCMS; Tomic Sindjelic GrozaCMS advised the UK's Poseidon Group and Belgium's Mitiska Reim on the divestment of their entire portfolio of retail parks in Serbia to Austria's Immofinanz AG. Tomic Sindjelic Groza advised Immofinanz on the deal.N/AAustria; SerbiaHere
26-JunCerha Hempel; SchoenherrCerha Hempel advised MK Group Global Limited on the acquisition of a loan portfolio from Heta Asset Resolution AG and the acquisition of the direct and indirect shareholdings of HETA in three Slovenian wind-down entities that manage receivables from non-performing loans granted by the former Hypo Alpe-Adria-Bank International AG and its subsidiaries to customers in Slovenia. Schoenherr advised the Republic of Austria as the owner of HETA.N/AAustria; SloveniaHere
5-AugSchoenherr; Wolf TheissSchoenherr advised S&T AG on its acquisition of Iskratel, d. o. o. Wolf Theiss advised the seller.EUR38millionAustria; Slovenia
9-OctEisenberger & Herzog; Milbank; Rojs, Peljhan, Prelesnik & Partners; SchoenherrEisenberger & Herzog, Milbank, and Rojs, Peljhan, Prelesnik & Partners advised the Sartorius Group on its acquisition of BIA Separations and its merger into its Sartorius Stedim Biotech subgroup. Schoenherr advised the unidentified majority shareholder of BIA Separations on the sale.EUR360millionAustria; SloveniaHere
16-NovDLA Piper; Kirm PerparDLA Piper and Kirm Perpar successfully represented the Slovenian municipality of Kranjska Gora in an arbitration proceeding adjudicated at the Vienna International Arbitration Center against WTE Wassertechnik GmbH, a German supplier for municipal and industrial water management.N/AAustria; SloveniaHere
29-JanSchoenherrSchoenherr advised TTTech Auto AG on its acquisition of 51% stake in Turkish automotive driver assistance software company Red Pine Software Inc. from Cem Sezer. Solo practitioner Merve Isgoren advised the seller.N/AAustria; Turkey
17-JanSorainenSorainen advised Data Delivery LLC, a Belarus-based developer of the RocketData.io platform for managing business reputation and online data, on implementing share options for employees.N/ABelarusHere
13-FebAleinikov & PartnersAleinikov & Partners is representing Blitz Team in a dispute with Wargaming, developer of the game World of Tanks.USD1.69millionBelarusHere
13-FebAleinikov & PartnersAleinikov & Partners advised Playrix on an unspecified investment in Belarusian studio Vizor Games.N/ABelarusHere
27-FebRevera; SBHSBH advised Zubr Capital on the investment by its Zubr Capital Fund I in the Myfin Group, an IT platform for banking products. Revera advised Myfin Group on the transaction.N/ABelarusHere
1-MayArzingerArzinger Law Offices advised Belarusian Railway regarding loan and account pledge agreements with the Export-Import Bank of China.EUR66.7millionBelarus
4-MayEPAP; SorainenSorainen advised DEG on the acquisition of a stake in Belgips, a Belarusian manufacturer of gypsum-based building materials. Belgips was advised by Egorov Puginsky Afanasiev & Partners.N/ABelarusHere
26-MaySorainenSorainen successfully represented Belomo, a Belarusian enterprise specializing in optomechanical and optoelectronic equipment, in arbitration before the International Court of Arbitration of the International Chamber of Commerce.N/ABelarusHere
3-JunBNT Attorneys; SorainenSorainen advised ERGO Group on the sale of its Belarusian non-life subsidiary, ERGO Insurance Company, to the Euroins Insurance Group. BNT advised the Euronis Insurance Group.N/ABelarusHere
1-JulArzingerArzinger Law Offices advised Belarusbank on a loan from UBS Switzerland AG.EUR89millionBelarus
1-JulArzingerArzinger Law Offices advised Holding Belorusskie Oboi during negotiations with Austrian company Andritz on the terms of an investment project involving the re-equipment of the Dobrush Paper Factory.EUR36millionBelarus
16-JulAleinikov & PartnersAleinikov & Partners has advised StringersHub on investment into the company by a group of angel investors and venture capital firms Insta Ventures and Starta Ventures.USD500000BelarusHere
20-JulArzingerArzinger Law Offices represented Azeraluminium in an antidumping investigation concerning imports to the Eurasian Economic Union of aluminium tape produced in Azerbaijan and China.USD3.5millionBelarus
7-OctSorainenSorainen advised Australia's Aristocrat Digital gambling machine manufacturer on an undisclosed investment in Belarusian game development studio Neskin Games.N/ABelarusHere
26-OctSorainenSorainen helped the Turkey Wealth Fund obtain approval from the Ministry of Antimonopoly Regulation and Trade of the Republic of Belarus for its acquisition of control over Belarusian telecommunications network CJSC.N/ABelarusHere
1-DecArzingerArzinger Law Offices advised the Ministry of Natural Resources and Environment of the Republic of Belarus on matters related to an international technical assistance project involving the development of wind energetics in the Republic of Belarus.N/ABelarus
1-NovBDV Legal; Borovtsov & SaleiBorovtsov & Salei and BDV Legal advised the Croatian Bank for Reconstruction and Development on funding of Be Cloud within a Buyer Credit Facility Agreement aimed at financing an export contract with Ericsson Nikola Tesla d.d. invoving the supply of equipment and software for the creation of a single LTE cellular mobile telecom network in Belarus.EUR15millionBelarus; Croatia
7-AprSorainenSorainen advised the Kaamos Group, its Estonian subsidiary Kamos Timber, and its Belarusian subsidiary, Mozyr Sawmill, on a EUR 15 million loan it received from the EBRD for the construction of a new sawmill in Belarus.EUR15millionBelarus; EstoniaHere
3-DecBaker Mckenzie; Cobalt; NjordCobalt and Baker McKenzie advised Flugger on its acquisition of 70% of the shares in the Eskaro Group, advised by Njord.EUR8.4millionBelarus; Estonia; LatviaHere
7-AugDrakopoulos; Rosenfeld FarmerDrakopoulos and Rosenfeld Farmer represented Suraleb in litigation against Minsk Tractor Works involving the enforcement of a UNCITRAL arbitral award.EUR3millionBelarus; Romania
1-JunArzingerArzinger Law Offices advised Belarusbank and Eximbank on a loan agreement related to financing and refinancing settlements of Belarusbank's corporate clients under trade contracts.EUR30millionBelarus; Russia
1-SepBorovtsov & Salei; ĂŠ ĂŠ ĂŠ ĂŠ ĂŠ ĂŠ ĂŠ ĂŠ ĂŠ ĂŠ ĂŠ ĂŠ ĂŠ Morgan Lewis & BockiusBorovtsov & Salei and Morgan Lewis advised Russia's VTB Bank Public Stock Company on the execution of a Master Agreement on Derivatives and Swaps with Belagroprombank.N/ABelarus; Russia
24-NovAksu Caliskan Beygo Attorney Partnership; Clifford Chance; Durukan+Partners; Herguner Bilgen Ozeke; Kabine Law Firm; Kinstellar; Milbank, Tweed, Hadley & Mccloy; Skadden, Arps, Slate, Meagher & Flom; Stibbe; Sullivan & Cromwell; White & CaseIstanbul's Durukan+Partners and Skadden Arps advised LetterOne on theĂŠ restructuring of Turkcell's shareholding structure. Milbank and Turkey's Aksu Caliskan Beygo Attorney Partnership advised the Turkey Wealth Fund and Ziraat Bank, Sullivan & Cromwell and Herguner Bilgen Ozeke advised Telia Finland, and White & Case and the Kabine Law Firm advised Cukurova on the deal. Clifford Chance advised Citibank on English law. Stibbe London B.V. advised IMTIS on Dutch law. Kinstellar advised the Turkish Wealth Fund on Ukrainian law.USD2.38billionBelarus; Turkey; UkraineHere
28-JulIlyashev & PartnersActing on behalf of Challenge Shipping Ltd., the Odesa office of Ilyashev & Partners secured the acceptance by Ukraine's State Ecological Inspection of a British protection and indemnity club's letter of undertaking as a sufficient security for a maritime claim.UAH13.5millionBelarus; UkraineHere
21-JanBaros Bicakcic & PartnersBaros, Bicakcic & Partners successfully persuaded the High Commercial Court in Banja Luka to uphold a decision obliging Addiko Bank to pay Vucko d.o.o. Jahorina a total of over BAM 1 million in damages, interest, and court costs.BAM1millionBosnia and HerzegovinaHere
12-MayMaric & Co.Maric & Co advised the European Investment Bank on a loan to Intesa Sanpaolo Bank in Bosnia and Herzegovina.EUR60millionBosnia and HerzegovinaHere
22-MayMaric & Co.Maric & Co advised Shandong International and its Bosnian subsidiary SDHS-CSI BH Banja Luka on the Banja Luka-Prijedor-Novi Grad highway construction project.EUR300millionBosnia and HerzegovinaHere
16-JunLaw Firm SajicLaw Firm Sajic represented Del Mestri, the founder of the first private elementary school on the territory of the Republic of Srpska, before the Ministry of Education and Culture of Republic of Srpska and before the registration court.N/ABosnia and Herzegovina
20-AugMaric & Co.Maric & Co successfully represented the interests of Swietelsky Baugesellschaft m.b.H in the Constitutional Court of Bosnia and Herzegovina in appellate proceedings regarding a tax dispute against the country's Office for Indirect Taxation.BAM3millionBosnia and HerzegovinaHere
4-NovLaw Firm SajicLaw Firm Sajic conducted a data protection impact assesment for SberBank a.d. Banja Luka to help identify and mitigate potential risks to privacy and comply with data protection law when processing personal data.N/ABosnia and Herzegovina
24-DecDimitrijevic & Partners; Mihaj Ilic Milanovic; Mikijelj Jankovic & BogdanovicDimitrijevic & Partners, Mihaj Ilic Milanovic, and Mikijelj Jankovic & Bogdanovic successfully represented Bosnia and Herzegovina in an investment arbitration with Naveen Aggarwal, Neeta Gupta, and Usha Industries.USD30.2millionBosnia and HerzegovinaHere
1-JunBDK Advokati; De Brauw Blackstone Westbroek; Elvinger Hoss Prussen; Kirkland & Ellis; Linklaters; Maric & Co.; Selih & Partners; Wolf TheissLinklaters as the lead advisor, together with Harrisons as Serbian legal counsel, Wolf Theis as Slovenian counsel, and Maric & Co. as Bosnian counsel, assisted JP Morgan Securities, KKR Capital Markets Limited, Credit Suisse Securities, Credit Agricole Corporate and Investment Bank, Banca IMI SpA London Branch, Morgan Staley & Co. International, Raiffeisen Bank International, UniCredit Bank AG, BNP Paribas with a) offering by United Group B.V. of EUR 1.05 billion of fixed and floating rate senior secured notes due 2026 and EUR 575, aggregate principal amount of fixed rate senior secured notes due 2028; and b) the offering by Summer Bidco B.V. of EUR 170 million 9.00%/9.75% Senior HoldCo Pay-If-You-Can PIK Notes due 2025. Kirkland & Ellis acted as the lead law advisors to the United Group B.V. as the issuer; De Brauw Blackstone Westbroek N.V. as Dutch counsel for the issuer and the guarantors; Elvinger Hoss Prussen as Luxembourg counsel for the issuer and the guarantors; BDK as Serbian legal counsel to the issuer; and Selih & Partners as Slovenian counsel for the issuer and the guarantors.EUR1.795billionBosnia and Herzegovina; Bulgaria; Serbia; Slovenia
15-DecBDK Advokati; De Brauw Blackstone Westbroek; Elvinger Hoss Prussen; Kirkland & Ellis; Linklaters; Maric & Co.; Selih & Partners; Wolf TheissLinklaters as the lead advisor, working with Harrisons as Serbian legal counsel, Wolf Theis as Slovenian counsel, and Maric & Co. as Bosnian counsel, assisted JP Morgan, KKR Capital Markets Partners, Credit Suisse Securities, Credit Agricole Corporate and Investment Bank, Intesa Sanpaolo, Morgan Stanley & Co. International, Raiffeisen Bank International, UniCredit Bank AG, BNP Paribas, ING Bank N.V. London Branch with the offering by United Group B.V. of EUR 400 million 4.00% senior secured notes due 2027. Kirkland & Ellis acted as the lead law advisors to the United Group B.V. as the issuer; De Brauw Blackstone Westbroek N.V. as Dutch counsel for the issuer and the guarantors; Elvinger Hoss Prussen as Luxembourg counsel for the issuer and the guarantors; BDK as Serbian legal counsel to the issuer; and Selih & Partners as Slovenian counsel for the issuer and the guarantors.EUR400millionBosnia and Herzegovina; Bulgaria; Serbia; Slovenia
14-SepDWF; Kinstellar; Law Firm SajicKinstellar's Belgrade Office successfully advised the Serbian Orthodox Church on a case heard by an English High Court regarding claims of alleged abuse by clergymen in Serbia, Bosnia-Herzegovina, and Croatia. DWF and Michael McParland, QC, also provided legal assistance to the Church in the UK. Law Firm Sajic acted as legal consultant for Kinstellar.N/ABosnia and Herzegovina; Croatia; SerbiaHere
5-MarKinstellar; Law Firm SajicKinstellar and Law Firm Sajic advised Nova Ljubljanska Banka d.d. on the conclusion of a share purchase agreement with the Republic of Serbia for the acquisition of an 83.23% ordinary shareholding in Komercijalna Banka a.d. Beograd.N/ABosnia and Herzegovina; Kosovo; Montenegro; North Macedonia; Serbia; SloveniaHere
26-AugDLA Piper; Miro SenicaMiro Senica and DLA Piper assisted Updata Partners with the legal due diligence of Slovenia's HYCU d.o.o., related to Updata Partners' potential acquisition of a controlling interest in HYCU, d.o.o.'s parent compamy, HYCU, Inc.N/ABosnia and Herzegovina; Serbia; Slovenia
16-JanDjingov, Gouginski, Kyutchukov & VelichkovDGKV successfully defended the interests of Mayoral Moda Infantil S.A. and its Bulgarian subsidiary Mayoral Bulgaria EOOD before the Bulgarian Commission for Protection of Competition in a case brought by Comsed involving allegations of superior bargaining position.N/ABulgariaHere
23-JanKirkland & Ellis; Linklaters; Shchoenherr; Wolf TheissSchoenherr and Kirkland & Ellis advised the United Group on Bulgarian legal aspects of its EUR 1.675 billion bonds issuance and on the structuring of the Bulgarian security package. The financing was related to its acquisition of the Bulgarian Telecommunications Company / Vivacom. Linklaters and Wolf Theiss advised global coordinator and physical bookrunner J.P. Morgan.EUR1.675billionBulgaria
27-JanGeorgiev, Todorov & Co.Georgiev, Todorov & Co successfully defended the interests of Multi-profile Hospital for Active Treatment Doverie against Bulgaria's National Health Insurance Fund in a dispute involving payment for medical care provided by the hospital to health-insured persons above the limits set by the NHIF.N/ABulgariaHere
29-JanKambourov & PartnersKambourov & Partners advised Spain's Bankia bank on a loan portfolio transfer in which part of the receivables was secured by collateral provided by Bulgarian companies.N/ABulgariaHere
31-JanSchoenherrSchoenherr advised OMV Petrom on the competition law aspects of its acquisition of a participation in the Han Asparuh exploration licence in Bulgaria.N/ABulgaria
6-FebKinstellarKinstellar advised GTC on its lease of of 4,000 square meters in the Advance Business Center II, an office building in Sofia, Bulgaria, that is expected to open near the end of this year.N/ABulgariaHere
11-FebTokushev And PartnersTokushev and Partners advised DZI - General Insurance on its acquisition of Mall Varna from Hydrostroy.EUR16millionBulgariaHere
13-FebKambourov & PartnersKambourov & Partners advised Yotpo on its acquisition of SMSBump.N/ABulgariaHere
14-FebCMS; Dinova, Rusev & PartnersCMS advised OTP Bank and DSK Bank on the refinancing of a shopping mall. Dinova, Rusev & Partners advised the borrower.EUR85millionBulgaria
17-FebCMSCMS helped Korea's SDN Company Ltd regain control over photo-voltaic producer EU Sunday AD.N/ABulgariaHere
20-FebGeorgiev, Todorov & Co.Georgiev, Todorov & Co successfully defended the rights of Multi-Profile hospital for Active Treatment Europe against the Ministry of Health of Bulgaria.N/ABulgariaHere
11-MarKinstellarKinstellar advised the EBRD on its first loan under the EUR 200 million Bulgarian Water Sector Financing Framework to Ruse Water Supply and Sanitation Company.EUR200millionBulgariaHere
17-MarKambourov & Partners; Wolf TheissKambourov & Partners advised DS Smith on Bulgarian aspects of the sale of it plastic packaging business to Liquibox. Wolf Theiss advised Liquidbox on the deal.N/ABulgariaHere
17-MarD'Ornano Partners; SchoenherrD'Ornano Partners advised the Groupama Group on its acquisition of Express Life Bulgaria IJSC, a member of the OTP Group. Schoenherr advised the OTP Group on the deal.N/ABulgariaHere
26-MarTsvetkova Bebov KomarevskiTsvetkova Bebov Komarevski advised Eleven Capital on its IPO.N/ABulgariaHere
27-MarKambourov & PartnersKambourov & Partners advised DEV.bg, a Bulgarian IT community developer, on the EUR 200,000 acquisition by hosting and software development company SiteGround of newly issued shares representing a 10% stake in the company.EUR200000BulgariaHere
15-AprSchoenherrSchoenherr advised specialty chemical company Clariant SE on its potential rights in its capacity as a licensor in the event of the insolvency of a Bulgarian company-licensee, a large and complex bio fuel plant.N/ABulgaria
23-AprBuzeva & Partners; CMSCMS has helped Bulgaria's Global Biome settle a dispute with the Sustainable Energy Development Fund related to recent changes to Bulgarian legislation. The SEDF was advised by Buzeva & Partners.N/ABulgariaHere
6-MayGeorgiev, Todorov & Co.Georgiev, Todorov & Co successfully defended the rights of concessionaire BMF Port Burgas - Burgas East 2 and Burgas West port terminals - in an appeal of the Energy and Water Regulatory Commission's decision in a dispute concerning direct connection to electricity grids.N/ABulgariaHere
12-MayCMSCMS Sofia advised Korean investors KOSEP and SDN on a additional EUR 10 million financing obtained from UniCredit Bulbank AD, Expressbank AD, and DSK Bank EAD for two 42 MWp photovoltaic projects in Bulgaria. CMS Vienna advised the lenders.EUR10millionBulgariaHere
28-MayCMSCMS advised Korea's Solarian Holdings Ltd. on the acquisition of a 5 MW photovoltaic power plant in Bulgaria from FEC Perun.N/ABulgariaHere
15-JunKambourov & Partners; KinstellarKinstellar and Kambourov & Partners served as legal counsel to the SOF Connect consortium on litigation related to its successful participation in the tender that resulted in its receiving the 35-year concession to operate the Sofia airport.N/ABulgariaHere
18-JunBoyanov & Co; KinstellarKinstellar advised regional property developer Globe Trade Center on negotiations with Germany's Commerzbank to lease 3,500 square meters of space at Sofia' Advance Business Center II office building. Boyanov & Co advised Commerzbank on the deal.N/ABulgariaHere
19-JunSchoenherSchoenherr advised the Balkan Advisory Company in a dispute with TBI Bank concerning an IPO.N/ABulgaria
22-JunGeorgiev, Todorov & Co.Georgiev, Todorov & Co advised COMSED JSC, the largest retail chain for toys and children's accessories in Bulgaria, on a change in the ownership structure of the company.EUR1millionBulgariaHere
26-JunGeorgiev, Todorov & Co.Georgiev, Todorov & Co successfully represented the Port of Burgas on its appeal of a decision of the Energy and Water Regulatory Commission regarding a connection to Bulgaria's national electricity transmission grid.N/ABulgariaHere
1-JulCMS; Terziyski & Partners Legal PartnershipCMS acted for private property investor Strategy Solution Ltd. on its EUR 1.4 million acquisition of a landmark office building in Sofia, Bulgaria, from six private individuals. Terziyski & Partners advised the sellers.N/ABulgariaHere
8-JulKinstellarKinstellar advised Silversmith Capital Partners, a Boston-based growth equity firm, on Appfire's acquisition of Botron Software, a Bulgaria-based provider of tools that enable enterprise-level change and configuration management within the Jira software platform.N/ABulgariaHere
14-JulBoyanov & CoBoyanov & Co. advised the Valea Foundation on the acquisition of a minority capital package in FIB Bank.N/ABulgariaHere
15-JulDimitrov Petrov & Co.Dimitrov, Petrov & Co. assisted with the spin-off of CETIN Bulgaria from PPF Telenor.N/ABulgariaHere
17-JulDjingov, Gouginski, Kyutchukov & VelichkovDGKV advised Bulgarian start-up Nasekomo on the investment into the company of EUR 4 million from VC funds Morningside Hill and New Vision 3 backed by the Fund of Funds in Bulgaria.EUR4millionBulgariaHere
17-JulKinstellarKinstellar advised OTP Bank and its Bulgarian subsidiary, DSK Bank, on a EUR 25 million loan provided to Balkan Business Center AD for the construction and operation of the Balkan Business Center office complex in Sofia.EUR25millionBulgariaHere
21-JulGeorgiev, Todorov & Co.Georgiev, Todorov & Co. successfully represented Sofia's Acibadem City Clinic Multidisciplinary Hospital for Active Treatment Tokuda EAD in a claim against Bulgaria's National Health Insurance Fund for payment for medical care provided by the hospital to health-insured persons above the NHIF's limits.N/ABulgariaHere
27-JulCMS; Eurolex BulgariaEurolex Bulgaria and CMS advised Trace Group Holding and Balkantel - members of the Plovdiv Railway Project Consortium - on their successful participation in a tender for a EUR 45 million railway public procurement project in Bulgaria.EUR45millionBulgariaHere
30-JulDimitrov Petrov & Co.; Vladimirov KiskinovDimitrov, Petrov & Co. advised Team.blue on its acquisition of the Bulgarian web hosting company SuperHosting. The Vladimirov Kiskinov law firm advised SuperHosting on the deal.N/ABulgariaHere
31-JulBoyanov & CoBoyanov & Co successfully represented Organic Land Corporation EOOD, a Bulgarian subsidiary of Tradin Organic B.V., in litigation against an unidentified agricultural company.N/ABulgariaHere
3-AugLacore; Tsvetkova Bebov KomarevskiSeparate teams from Tsvetkova Bebov Komarevski advised both EnduroSat and Freigeist Capital on the latter's investment into the former. Lacore Rechtsanwalte was German counsel to Freigeist Capital.N/ABulgariaHere
5-AugHengeler Mueller; Orrick Herrington & Sutcliffe; SchoenherrSchoenherr and Hengeler Mueller advised Schneider Electric SE on the Bulgarian legal aspects of the acquisition of ProLeiT AG. Orrick Herrington & Sutcliffe advised the target.N/ABulgaria
7-AugCMS; Mamo TCV Advocates; Maples Group; Reed Smith; Wolf TheissCMS advised OTP Bank, DSK Bank, and Eurobank on the EUR 110 million refinancing of the Business Park Sofia with Arco Capital Corporation. Reed Smith and Wolf Theiss advised Arco Capital on the transaction. Mamo TCV Advocates advised the lenders on Maltese law while Maples Group advised the lenders on Cayman law.EUR110millionBulgariaHere
13-AugEpstein Rosenblum Maoz; Georgiev, Todorov & Co.Georgiev Todorov & Co. advised Bulgaria's Office Sgradi EOOD on the purchase of 50% of the shares of Medical Center-On Clinic Bulgaria AD from the Netherlands-based On Clinic Advanced Medical Institute B.V. The seller was reportedly advised by Israel's Epstein Rosenblum Maoz.N/ABulgariaHere
14-AugTokushev and PartnersTokushev and Partners advised Intercapital Property Development REIT on its initial public offering of company shares worth over BGN 24 million.BGN24millionBulgariaHere
18-AugGugushev & Partners; Shearman & Sterling; Wolf TheissGugushev & Partners acted as the Bulgarian counsel to several initial purchasers represented by Barclays Capital Inc. in relation to the USD 750 million note offering by Sensata Technologies, Inc., USA. Shearman & Sterling was the lead counsel to the purchasers and Wolf Theiss was the counsel to Sensata.USD750millionBulgaria
18-AugGugushev & PartnersGugushev & Partners Law Office successfully represented the National Railway Infrastructure Company before a Court of Arbitration ad hoc to the Bulgarian Chamber of Commerce and Industry with respect to a claim for payments under a FIDIC Contract for Rehabilitation and Electrification of the Railway Plovdiv-Svilengrad.EUR36millionBulgaria
21-AugCMSCMS advised Korea's Solarian Holdings Ltd. on the acquisition of a 2.25 Megawatt photovoltaic power plant in Bulgaria from Julian Torchanov and Mat Ltd.N/ABulgariaHere
8-SepHerbert Smith; SchoenherrSchoenherr advised BNP Paribas S.A. Citibank NA, London Branch, and Black Sea Trade and Development Bank on Bulgarian legal aspects of a EUR 90 million syndicated credit facility extended to Oliva AD and Buildcom EOOD, as well as on the establishment of a Bulgarian security package for the facility. Herbert Smith Freehills acted as English law counsel to the banks.EUR90millionBulgariaHere
9-SepDjingov, Gouginski, Kyutchukov & Velichkov; Tokushev and PartnersTokushev and Partners advised Oliva AD, the largest grain trader and oilseeds crusher in Bulgaria, on its acquisition of all long-term assets of the Kaliakra plant in Dobrich, Bulgaria, from Kaliakra AD, the Bulgarian subsidiary of Bunge. Djingov, Gouginski, Kyutchukov, and Velichkov advised Kaliakra on the deal.USD2.3millionBulgariaHere
15-SepAllen & Overy; CMS; Memery Crystal; Schoenherr; Spasov & BratanovCMS advised ACWA Power, Blackrock, and Crescent Capital on their sale of ACWA Power CF Karad PV Park and NOMAC Bulgaria, which operate the 60 MWp Karadzhalovo photovoltaic plant in Bulgaria, to Enery Development GmbH. Schoenherr and Memery Crystal advised the buyer on the deal, including on one of the first ever commercial refinancing of an existing financing granted by the International Finance Corporation (IFC) and the U.S. International Development Finance Corporation (DFC) by a EUR 95 million bond issue under Austrian law and via intra-group lendings as well as on the concurrent acquisition financing. Allen & Overy and Spasov & Bratanov advised to the existing lenders - IFC and DFC.EUR95millionBulgariaHere
21-SepDjingov, Gouginski, Kyutchukov & VelichkovDjingov, Gouginski, Kyutchukov & Velichkov advised OTP Bank and DSK Bank on financing provided to Minstroy Properties EOOD for the development of NV Tower, a high-rise office building in Sofia.N/ABulgariaHere
22-SepKinstellarKinstellar advised the EBRD on a EUR 40 million agreement with Raiffeisebank Bulgaria.EUR40millionBulgariaHere
25-SepDjingov, Gouginski, Kyutchukov & Velichkov; Jordanov, Valkov & PartnersDGKV advised Dow Jones International on the execution of a lease agreement for the company's new office in Sofia. The lessor, T.I.M-X OOD, was advised by the Jordanov, Valkov & Partners law firm.N/ABulgariaHere
25-SepDjingov, Gouginski, Kyutchukov & VelichkovDGKV advised Sitel Bulgaria on extending ite lease and renegotiating certain lease provisions necessitated by the COVID-19 pandemic.N/ABulgariaHere
9-OctClifford Chance; Djingov, Gouginski, Kyutchukov & Velichkov; Linklaters; Tsvetkova Bebov KomarevskiTsvetkova Bebov Komarevski and Clifford Chance advised the Republic of Bulgaria on its dual tranche EUR 2.5 billion eurobond issuance. DGKV and Linklaters advised lead managers Citi, JP Morgan, BNP Paribas, and Unicredit.EUR2.5billionBulgariaHere
15-OctCMSCMS advised the Italian-Saudi Arabian Arkad Consortium on the amendment and supplement of a public procurement agreement for materials and equipment, investment design-phase detailed design, construction, and commissioning of the Balkan Stream gas pipeline project.N/ABulgariaHere
20-OctCMSCMS successfully represented ASM-BG Investicii in a dispute with ESO EAD, Bulgaria's state-owned electricity transmission system operator, heard by the Arbitration Court of the Bulgarian Chamber of Commerce and Industry.N/ABulgariaHere
23-OctCMS; Memery Crystal; SchoenherrSchoenherr advised the MET Group on the acquisition of a 100% stake in a 42MW wind park in the Kavarna region of Bulgaria from Enel Green Power. Memery Crystal provided English law advice to the MET Group. CMS advised Enel Green Power on the transactionN/ABulgariaHere
6-NovHristov PartnersHristov & Partners advised MTD Products, an Ohio-based manufacturer of outdoor power and lawn care equipment, on the restructuring of its business operations in Bulgaria.N/ABulgariaHere
13-NovDjingov, Gouginski, Kyutchukov & Velichkov; Go2Law; Vedder PriceGo2Law and Djingov, Gouginski, Kyutchukov & Velichkov advised Integral Venture Partners on an unspecified investment in Bulgarian telecommunications company Bulsatcom. Vedder Price advised selling shareholders Blantyre Capital and the EBRD.N/ABulgariaHere
18-NovGugushev & PartnersGugushev & Partners helped Fr. Lurssen Werft GmbH & Co KG, part of Northern Germany's Lurssen shipyard group, win a public tender for the supply of two multipurpose modular patrol vessels to the Bulgarian Navy.EUR500millionBulgariaHere
27-NovBoyanov & CoBoyanov & Co helped Ideal Standard Vidima obtain a loan of EUR 65 million, with EUR 45 million coming the DSK Bank and another EUR 20 million from the United Bulgarian Bank.EUR65millionBulgariaHere
29-DecKinstellarKinstellar advised Allianz Bulgaria on its lease of office space from Park Lane Developments in Sofia.N/ABulgariaHere
21-OctLatham & Watkins; Paul Hastings; SchoenherrSchoenherr and Paul Hastings advised lender and administrative agent Monroe Capital and a group of companies affiliated with Marlin Equity Partners (in their capacities as Borrowers/Guarantors), on a USD 270 million financing for the acquisition of hospitality management technology players Fourth and HotSchedules, which were then subsequently merged into Fourth. Latham & Watkins advised the obligators and Fourth.EUR270millionBulgaria
4-DecSchoenherrSchoenherr advised Leoni AG on its entry into the Bulgarian market and the lease and construction of a production factory in Bulgaria.EUR32millionBulgaria
27-MarSchoenherr; Wolf TheissSchoenherr advised Enery Power Holding GmbH on the Bulgarian legal aspects of a EUR 35 million mezzanine bond issuance used to finance its acquisition of a Bulgarian solar park. Wolf Theiss advised the bondholders.EUR35millionBulgaria; Austria
17-AprDentons; Djingov, Gouginski, Kyutchukov & Velichkov; Ilej & Partners; Karanovic & Partners; SchoenherrDentons, DGKV, Karanovic & Partners, and Ilej & Partners in cooperation with Karanovic & Partners advised Hungary's Optima Befektesi Alapkezelo on its acquisition of a 61.49% share in Globe Trade Centre S.A. from Lone Star Funds. Schoenherr advised the sellers on the deal.N/ABulgaria; Croatia; Poland; Romania; SerbiaHere
1-FebWolf TheissWolf Theiss Bucharest advised Addiko Bank, Privredna Banka Zagreb, Zagrebacka Banka, and Raiffeisen Austria regarding the club loan of EUR 120 million to Croatian retail company Orbico d.o.o. and subsidiaries.EUR120millionBulgaria; Croatia; Poland; Romania; Slovenia
31-MarHogan Lovells; Schoenherr; Wolf TheissSchoenherr and Hogan Lovells advised Ares Management Limited on the EUR 75.78 million financing for Kohlberg's acquisition of the K2 Sports and Marker Dalbello Volkl businesses in the Czech Republic and Bulgaria. Wolf Theiss Bulgaria advised the borrower and the Bulgarian pledgors.EUR75.78millionBulgaria; Czech Republic
1-FebLakatos, Koves & Partners; Weil, Gotshal & Manges; White & CaseLKT advised Walmark on Hungarian matters related to the sale of its Pharmavit business to Supremax - a carve-out transaction resulting from the sale of Walmark to Stada due to competition considerations. Kinstellar advised Supremax. LKT, Weil, Gotshal & Manges, and White & Case acted as advisors to MidEuropa on the original Walmark and Strada deal.N/ABulgaria; Czech Republic; Hungary; Poland; Romania; Slovakia
16-NovGoodwin Procter; Kinstellar; LinklatersKinstellar and Goodwin Procter advised GTT Communications on the USD 2.15 billion sale of its business infrastructure in Central, Southern, and Eastern Europe to I Squared Capital. Linklaters advised the buyer on the deal.USD2.15billionBulgaria; Czech Republic; Hungary; Romania; Serbia; Slovakia; UkraineHere
1-SepDrakopoulos; Kambourov & Partners; Lambadarios Law FirmKambourov & Partners and Drakopoulos advised Bulgartransgaz EAD on its acquisition of a 20% stake in Gastrade S.A. Lambadarios Law Firm advised the Public Gas Corporation of Greece.EUR12.5millionBulgaria; GreeceHere
27-FebAkol Law Firm; Georgiev, Todorov & Co.; Kolcuoglu Demirkan Kocakli; Yordanov & RachevGeorgiev, Todorov & Co., Akol Law Firm, and Yordanov & Rachev advised Fleet Services, which currently operates through GPS Bulgaria and GPS Systems Macedonia, on the purchase of all shares of the capital of Turkish GPS company Mobiliz Bilgi ve Iletisim Teknolojileri Sirketi. Kolcuoglu Demirkan Kocakli advised the sellers.N/ABulgaria; Macedonia; Turkey
5-FebNoerr; Penkov Markov & PartnersNoerr and Penkov, Markov & Partners advised private equity firm Aurelius Equity Opportunities SE & Co. KGaA on the acquisition of the Renewable Power Systems and Protection Relays businesses from Woodward, Inc.N/ABulgaria; PolandHere
30-JanCMS; EY LawCMS advised Hyundai Electric & Energy Systems on the sale of its Bulgarian subsidiary Hyundai Heavy Industries Co. Bulgaria AD to Russia's SVEL Group. EY Law Russia advised the buyers.N/ABulgaria; RussiaHere
31-DecArsov Natchev Ganeva; CMS; Dentons; Djingov, Gouginski, Kyutchukov & Velichkov; Kpmg Legal; Latham & Watkins; Linklaters; Tsvetkova Bebov KomarevskiCMS and Arsov Natchev Ganeva advised contractor Arkad on the Balkan Stream Gas Pipeline project, which was completed at the end of December, 2020. Dentons, KPMG Legal, Tsvetkova Bebov Komarevski, and Latham & Watkins also advised the contractor on the deal. Linklaters and DGKV advised unspecified lenders on financing for the project.EUR1.1billionBulgaria; RussiaHere
21-OctAndric Law Office; CMS; Doklestic Repic & Gajin; Eurolex BulgariaCMS Sofia and Doklestic Repic & Gajin have advised Balkantel on its participation with the Trace Group in a EUR 60 million modernization and rehabilitation project of the Nis-Brestovac railway in southern Serbia. The Trace Group was advised by Eurolex Bulgaria and the Andric Law Office.EUR60millionBulgaria; SerbiaHere
1-MarAkol Law Firm; Kolcuoglu Demirkan KocakliAkol Law Firm assisted Sovos with its acquisition of Foriba. Kolcuoglu Demirkan Kocakli advised the sellers.USD53millionBulgaria; Turkey
27-MarKinstellarKinstellar advised Earlybird Venture Capital on its EUR 3 million seed funding of fintech startup Payhawk, a paperless corporate card used for simplifying expenses for businesses.EUR3millionBulgaria; TurkeyHere
11-AugAequo; CMS; Harney's; Jipyong; Sayenko KharenkoCMS advised the Export-Import Bank of Korea on a USD 36 million financing deal with Grain Terminal Holdings - a Singapore-based joint venture between Posco International and the Orexim Group. Posco International was advised by Aequo and South Korea's Jipyong law firm, and the Orexim Group was advised by Sayenko Kharenko and Harneys' Cyprus office.USD36millionBulgaria; UkraineHere
23-OctAkol Law Firm; DLA Piper; Herguner Bilgen Ozeke; Kambourov & PartnersDLA Piper advised Polhem Infra on Ukrainian aspects of its acquisition of telecommunication services provider Telia Carrier from the Telia Company. Kambourov & Partners acted as Bulgarian advisor to Polhem Infra on the deal. Herguner Bilgen Ozeke advised Telia and Akol Law Firm advised Polhem in Turkey.SEK9.4millionBulgaria; UkraineHere
31-MarPaul Hastings; SchoenherrSchoenherr and Paul Hastings advised Monroe Capital Investments on a USD 250 million loan to Fourth UK and on the security package over the assets of local subsidiary Fourth Bulgaria EOOD.USD250milionBulgaria; United States of America
24-JanMiskovic & MiskovicMiskovic & Miskovic advised Badel 1862 d.d. Zagreb on the structure and takeover process of target Vinoplod-Vinarija d.d. Sibenik in pre-bankruptcy proceedings.N/ACroatia
27-JanTus & AndrijanicTus & Andrijanic advised JGL d.d. on its HRK 130 million issuance of corporate bonds. The agent for the issue was Privredna Banka Zagreb d.d.HRK130millionCroatiaHere
18-FebKovacevic Prpic SimeunovicKPS advised a syndicate of the Croatian Bank for Reconstruction and Development, OTP Banka d.d., Privredna Banka Zagreb-Dionicko Drustvo, and Zagrebacka Banka d.d. on financing of up to HRK 537 million to Zagrebacki Elektricni Tramvaj d.o.o. for the construction of a Zagreb-Sljeme cable car line with carpark.EUR72millionCroatia
21-FebCipcic-Bragadin Mesic & Associates; Marohnic Tomek & Gjoic; Nozdrovicky, Suvert & Co.; Wolf Theiss; Zeljka Velic Dvorscak & Silvije SkerlevCipcic-Bragadin Mesic and Associates advised Nafta a.s. on the acquisition of 50% of investors' rights and sharing obligations under the 2016 Production Sharing Agreement entered into between Vermilion Zagreb Exploration and the Government of the Republic of Croatia. Marohnic Tomek & Gjoic, Zeljka Velic Dvorscak & Silvije Skerlev, and Nozdrovicky, Suvert & Co also advised Nafta on the deal, while Wolf Theiss advised Vermilion.N/ACroatiaHere
17-MarCipcic-Bragadin Mesic & AssociatesCipcic-Bragadin Mesic & Associates executed a public procurement advisory agreement with the Croatian Ministry of Public Administration in relation to the implementation of an e-Business project.HRK50millionCroatiaHere
31-MarCipcic-Bragadin Mesic & AssociatesCipcic-Bragadin Mesic & Associates announced the launch of a "Covid-19 + Zagreb Earthquake" pro bono project to help those affected by Covid-19 and/or the earthquake that rocked the Croatian capital on March 22, 2020.HRK1millionCroatiaHere
29-AprLovric Novokmet Smrcek; Wolf TheissLovric Novokmet Smrcek advised I4 Invention and Miodrag Mircetic on the sale of a majority shareholding in Tradeticity DOO to Italian-listed company Antares Vision, which was advised by Wolf Theiss.N/ACroatiaHere
30-AprFreshfields; Savoric & PartnersFreshfields advised agent Unicredit Bank AG and Bayerische Landesbank, BNP Paribas S.A., and Commerzbank Aktiengesellschaft in connection with financing for Flixmobility GmbH and its subsidiaries. Savoric & Partners advised on Croatian law.N/ACroatia
13-MayTus & Andrijanic; Wuersch & GeringCroatia's Tus & Andrijanic law firm, acting with New York's Wuersch & Gering lw firm, advised Budapest-based Lead Ventures Plc. on it EUR 3 million acquisition of an unspecified stake in insurtech start-up Amodo d.o.o.EUR3millionCroatiaHere
19-MayBabic & Partners; BDV Legal; Go2Law; Taylor Wessing; Wolf TheissGo2Law and BDV advised Optimapharm founders Igor and Gordana Cicak and Wolf Theiss advised investor Mezzanine Management on the sale of Optimapharm to the Rohatyn Group. Babic & Partners, Taylor Wessing, and Nauta Dutilh advised the Rohatyn Group on the deal.N/ACroatiaHere
29-MayBogdanovic, Dolicki & Partners; Savoric & PartnersSavoric & Partners advised Generali on its acquisition of the insurance portfolio of Izvor Osiguranje d.d. The seller was advised by Bogdanovic, Dolicki & Partners.N/ACroatia
1-JunKovacevic Prpic SimeunovicKPS was engaged by the Ministry of Finance of the Republic of Croatia to draft a regulation defining criteria for expert valuation and examination of publicly funded investment projects and related instructions for budget entities at the national and local (regional) levels.N/ACroatia
9-JunKovacevic Prpic Simeunovic; Pillsbury Winthrop Shaw PittmanKPS advised the lessor, owned by the World Star Aviation Group, on the delivery and lease of one Airbus A319-112 aircraft toĂŠ Croatian national air carrier Croatia Airlines. Pillsbury Winthrop Shaw Pittman advised the lessor on English law.N/ACroatia
9-JulBaker Mckenzie; Divjak Topic Bahtijarevic & KrkaDTB and Baker McKenzie advised mobile game developer Playrix on the acquisition of Croatian gaming studio Cateia Games.N/ACroatiaHere
31-AugLatham & Watkins; Morrison Foerster; Savoric & PartnersSavoric & Partners advised One Equity Partners on Croatian employment matters related to a project involving a strategic capital investment of over USD 200 million in global IT and telecommunications company Infobip. Morrison Foerster advised Infobip. Latham & Watkins acted as global advisor to One Equity Partners.USD200millionCroatia
7-SepBeiten BurkhardtBeiten Burkhardt advised Dr. Zwiebelhofer GmbH on the acquisition of two Croatian companies, KM Kovnica and KM Alati, from an unidentified seller, and on the two companies' reintegration into the Konig Metall Group, from which they had been sold in 2013.N/ACroatiaHere
9-SepCMS; Miskovic & MiskovicMiskovic & Miskovic advised Croatian design and development agency Infinum, and its shareholders, in a joint venture with Porsche Digital GmbH, the digital unit of Porsche AG. CMS advised Porsche Digital GmbH.EUR10millionCroatia
28-SepDivjak Topic Bahtijarevic & Krka; Mamic Peric Reberski RimacDTB advised Interxion on its acquisition of Altus IT in Croatia. Mamic Peric Reberski Rimac advised Altus IT on the deal.N/ACroatiaHere
30-SepDLA Piper; Glinska & Miskovic; Latham & Watkins; Savoric & PartnersSavoric & Partners, working alongside Latham & Watkins, advised Nanobit, a Croatian video game developer, on its acquisition by Sweden's Stillfront Group. The buyer was advised by Glinska & Miskovic and DLA Piper.USD148millionCroatia
9-OctCMS; SchoenherrSchoenherr advised S Immo AG on the acquisition of the Zagrebtower office complex from CA Immobilien Anlagen AG. CMS advised the sellers on the deal.N/ACroatiaHere
10-OctSavoric & PartnersSavoric & Partners acted for a syndicate of Privredna Banka Zagreb d.d., Zagrebacka Banka d.d., Sberbank d.d., and Croatian Bank for Reconstruction and Development, and agent Privredna Banka Zagreb d.d., in relation to financing granted to Valamar Riviera d.d.EUR66millionCroatia
21-OctDivjak Topic Bahtijarevic & Krka; Krehic & PartnersDTB advised US-based Devolver Digital on its acquisition of Croatian independent game development company Croteam. Krehic & Partners in cooperation with Deloitte Legal advised Croteam on the deal.N/ACroatiaHere
31-OctButerin & Posavec; Savoric & PartnersSavoric & Partners acted for Enterprise Fund VII, a private equity fund managed by Enterprise Investors, in its acquisition of the remaining 35% stake in Croatia's Pan-Pek bakery. Buterin & Posavec advised the seller.N/ACroatia
9-NovHelena Sjaus; Kovacevic Prpic SimeunovicKPS advised Privredna Banka Zagreb-Dionicko Drustvo, Sberbank d.d., and Raiffeisenbank Austria d.d. on financing for the construction of a new shopping mall. Solo practitioner Helena Sjaus advised the borrower.EUR17.2millionCroatia
26-NovMarohnic Tomek & Gjoic; Wolf TheissMarohnic, Tomek & Gjoic advised LCN Capital Partners on its acquisition of five Emmezeta retail and warehouse units in Croatia. Josip Martinic in cooperation with Wolf Theiss reportedly advised the seller on the deal.N/ACroatiaHere
30-NovBogdanovic, Dolicki & Partners; Brownstein Hyatt Farber Schreck; Dechert; Kirkland & Ellis; Savoric & PartnersSavoric & Partners and Dechert advised Microblink and its US partner BlinkReceipt, on its receipt of a USD 60 million minority investment led by Silversmith Capital Partners. Brownstein Hyatt Farber Schreck advised the target while Kirkland & Ellis and Bogdanovic, Dolicki & Partners advised Silversmith Capital.USD60millionCroatia
22-DecDivjak Topic Bahtijarevic & Krka; Eisenberger & Herzog; Tokic Ivic SverakDivjak Topic Bahtijarevic & Krka and Eisenberger & Herzog advised Austrian energy company Kelag on its acquisition of the Orjak wind farm in Croatia from BayWa. Tokic Ivic Sverak advised the seller on the deal.N/ACroatiaHere
30-DecKovacevic Prpic SimeunovicKPS advised UniCredit on financing for its acquisition of receivables from Officium Partners d.o.o.EUR24millionCroatia
30-AprClifford Chance; Divjak Topic Bahtijarevic & Krka; Savoric & PartnersSavoric & Partners, working alongside Clifford Chance, advised CVC Capital Partners in its acquisition of several companies from the Dogus Group. Divjak Topic Bahtijarevic & Krka advised the seller.N/ACroatia; Greece; Montenegro; Turkey
23-NovBird & Bird; Cipcic-Bragadin Mesic & Associates; Clifford Chance (Badea); Cobalt; Jadek & Pensa; Karanovic & Partners; Karanovic & Partners (Ilej & Partners)Cipcic-Bragadin Mesic & Associates assisted global lead counsel Bird & Bird on Pfizer's global business combination with Mylan N.V., involving the spin-off of Pfizer's Upjohn business and a subsequent merger of that business with Mylan N.V. to form a new global generics company called "Viatris." Karanovic & Partners provided local support in Serbia, Jadek & Pensa provided local support in Slovenia, Cobalt provided support in Latvia, and Clifford Chance provided local support in Romania.N/ACroatia; Latvia; Romania; Serbia; Slovenia;Here
29-MayAllen Overy; Savoric & PartnersSavoric & Partners, working alongside Allen & Overy, advised Powszechna Kasa Oszczednosci Bank Polski S.A., Bank Handlowy w Warszawie S.A., Bank Zachodni WBK S.A., and ING Bank Slaski S.A. in relation to the amendment and restatement of PLN 850 million multi-currency term loan facilities and a revolving facility agreement provided to Press Glass SA and its subsidiaries.PLN850millionCroatia; Poland
8-OctODI Law; Praljak & SvicODI Law and Praljak & Svic advised Tokic, a Croatian auto parts retail chain, on the acquisition of all shares in Slovenian tire distribution company Bartog from private individuals Jasna Bartolj Kotar and Darija Bartolj Umek. The sellers were advised by solo practitioners Mihael Prcic and Janez Tekavc.N/ACroatia; SloveniaHere
9-DecFreshfields; Linklaters; ODI LawFreshfields Bruckhaus Deringer advised the Copenhagen-based payment services provider Nets and its majority owner, Hellman & Friedman, on the EUR 7.8 billion all-share merger of Nets into Italy's paytech group Nexi. ODI Law acted as local advisor to Nexi in Slovenia and Croatia.EUR7.8billionCroatia; SloveniaHere
12-FebAkol Law Firm; Dentons; Mamic Peric Reberski Rimac; Savoric & Partners; White & CaseWhite & Case advised Mid Europa Partners on the merger of its portfolio company CMC Iletisim ve Cagri Merkezi Hizmetleri A.S. with Meritus Upravljanje d.o.o., part of M+ Group, in return for a 30% equity stake in the combined group. Dentons advisedd the target company. In Croatia, Savoric & Partners advised Mid Europa Partners while Mamic Peric Reberski Rimac advised the target. Akol Law Firm advised Mid Europa in Turkey.N/ACroatia; TurkeyHere
17-JanClifford Chance; Dentons; Simpson Thacher & BartlettDentons and Simpson Thacher advised Round Hill Capital and Blackstone Tactical Opportunities on the sale of a EUR 1.3 billion residential real estate portfolio in the Czech Republic to Swedish real estate company Heimstaden Bostad AB. Clifford Chance advised Heimstaden Bostad on the deal.EUR1.3billionCzech RepublicHere
24-JanKinstellarKinstellar advised Czech investment group Portiva on its acquisition of a 5000-square meter retail center in the Czech Republic from Austrian developer Aventin.CZK250millionCzech RepublicHere
25-JanFrank Bold; Havel & PartnersHavel & Partners advised Finland's Vexve Oy on its acquisition of 100% of Armatury Group a.s., a Czech manufacturer in the heavy industry segment. Frank Bold advised the seller.N/ACzech Republic
27-JanWeinhold LegalWeinhold Legal advised Czech insurance broker Renomia on its acquisition of FINVOX Financni Sluzby, a Czech company focusing on insurance, credit, and investment mediation.N/ACzech RepublicHere
27-JanKinstellarKinstellar advised Youplus Insurance International AG and myLife Lebensversicherung AG, members of Switzerland's Insurevolution Partners insurance group, on the acquisition of Czech and Slovak life and non-life insurance contract portfolios from Basler Sachversicherungs-AG and Basler Lebensversicherungs-AG.N/ACzech RepublicHere
27-JanClifford Chance; Hladky Legal; KroupahelanClifford Chance advised P & O Netherlands B.V. on the EUR 21.5 million sale of its 50% stake in the Technologicky Park Brno business center to the city of Brno. As a result of the deal, the city, which was advised by Hladky Legal and the Kroupahelan Law Firm, became the majority owner of the park.EUR21.5millionCzech RepublicHere
1-FebClifford Chance; Eversheds SutherlandEversheds Sutherland advised Emma Capital in connection with its acquisition of assisted reproduction clinics and the establishment of a joint venture with the sellers. Clifford Chance advised the sellers.N/ACzech Republic
4-FebKocian Solc BalastikKSB's helped the Experientia Foundation "transform and professionalize."N/ACzech RepublicHere
4-FebBPV Braun PartnersBPV Braun Partners advised Carrier Transicold on the sale of its Czech subsidiary.N/ACzech RepublicHere
5-FebJSK; KinstellarKinstellar advised Raiffeisenbank on financing for KWR Czech's acquisition of DCK Holoubkov, a company that produces all-plastic outdoor low-voltage distribution switchboards, from two unnamed individuals. KWR Czech, owned by BHS Fund II Private Equity, was advised by JSK on the deal.N/ACzech RepublicHere
13-FebWeinhold LegalWeinhold Legal advised Ceska Posta on its CZK 353 million sale of the St. Gabriel Monastery to the Cimex Group.CZK353millionCzech RepublicHere
14-FebBPV Braun Partners; Eversheds SutherlandBPV Braun Partners advised Unicapital Energy Group on the acquisition of PSP Technicke Sluzby. Eversheds Sutherland advised the sellers on the transaction.N/ACzech RepublicHere
20-FebAllen & OveryAllen & Overy advised sole lead manager JP Morgan on Moneta Money Bank's approximately CZK 2.6 billion domestic subordinated Tier 2 capital bond issuance.CZK2.6billionCzech RepublicHere
29-FebPRK PartnersPRK Partners advised Komercni Banka a.s. on financing provided to a joint venture established by Sekyra Group and Ungelt Services for the acquisition of land for the development of residential and commercial projects in Prague.EUR13.1millionCzech Republic
1-MarHavel & Partners; Norton Rose FulbrightHavel & Partners and Norton Rose Fulbright represented Wustenrot & Wurttenbergische AG on the sale of 100% shares in Wustenrot-Stavebni Pojistovna a.s. and Wustenrot Hypotecni Banka a.s. to Moneta Money Bank, a.s.EUR180millionCzech Republic
4-MarPwC LegalPwC Legal advised IBSA Group on the acquisition of its long-term distributor on the Czech market, IBI spol. s r.o. IBI was advised by Solo Practitioners Violeta Jirackova and Rostislav Zak.N/ACzech RepublicHere
16-MarKocian Solc BalastikKocian Solc Balastik advised Czech hosting company IGNUM on its acquisition of web hosting and server services provider Stable.cz.N/ACzech RepublicHere
16-MarKocian Solc BalastikKocian Solc Balastik advised Solitea on the acquisition of Axiom Provis Int.N/ACzech RepublicHere
17-MarWeinhold LegalWeinhold Legal advised Skolnik Holding s.r.o. on the acquisition of a majority stake in Hobra-Skolnik from Switzerland's Filtrox.N/ACzech RepublicHere
17-MarClifford Chance; DentonsClifford Chance advised Heimstaden Bostad AB on its EUR 1.3 billion acquisition of Residomo's residential portfolio, which consists of move 42,000 residential units primarily in the Moravia-Silesia region of the Czech Republic. Dentons advised Residomo on the deal.EUR1.3billionCzech RepublicHere
18-MarKinstellarKinstellar helped Portiva acquire Astrid Offices, an administrative center under development in Prague's Holesovice district.EUR19.5millionCzech RepublicHere
26-MarAllen & Overy; Clifford Chance; Milbank, Tweed, Hadley & MccloyAllen & Overy; Dentons; Fenwick & West; White & CaseEUR300millionCzech RepublicHere
31-MarPRK PartnersPRK Partners advised lead manager Komercni Banka a.s. on Equa Bank's mortgage bond issuance under the existing Debt Issuance Programme.CZK2billionCzech Republic
31-MarJohnson Stastny Kramarik; PRK PartnersPRK Partners advised Komercni Banka a.s. in connection with the financing of a large real estate development project in Prague realized by the Finep Group. Johnson Stastny Kramarik advised the borrower.EUR120millionCzech Republic
1-AprEversheds Sutherland; Havel & PartnersEversheds Sutherland advised the founder of Strojmetal on the sale of his controlling stake in the company to the MTX group. Havel & Partners advised the buyers.N/ACzech Republic
1-AprPRK PartnersPRK Partners advised Komercni Banka a.s. on the financing of a large real-estate residential development project in Prague known as "Kaskady Barrandov."EUR4.21millionCzech Republic
3-AprBPV Braun Partners; CEE AttorneysBPV Braun Partners advised Generali Investments CEE on its acquisition of a residential building in Prague. CEE Attorneys advised the unidentified seller on the deal.N/ACzech RepublicHere
8-AprClifford Chance; Dolecek AdvokatiClifford Chance advised Generali Real Estate on its acquisition of the Kotva Department Store, a 28,000 square meter seven-story building in the Prague city center, from PSN. Dolecek Advokati advised the sellers.N/ACzech RepublicHere
20-AprJSK; MavericksJSK advised Tilia Impact Ventures and Nation 1 on their investment in Dot Glasses, a provider of a radical new concept for prescription eyeglasses for people in need. The Mavericks law firm advised Dot Glasses on the deal.N/ACzech RepublicHere
20-AprAllen & Overy; Eversheds Sutherland; Linklaters; RTPREversheds Sutherland, as Czech and Romanian counsel, and Linklaters, as lead counsel, advised G4S, a British multinational security services company, on its corporate restructuring and subsequent sale of its cash solutions activities to Brink's. Allen & Overy and RTPR advised the buyers.N/ACzech Republic
24-AprBaker MckenzieBaker McKenzie advised Kofola CeskoSlovensko on its acquisition of rhe Karlovarska Korunni and Ondrasovka food and beverage companies.N/ACzech RepublicHere
1-MayClifford Chance; Eversheds SutherlandEversheds Sutherland advised DER Touristik Group GmbH, a German-based company and member of REWE group, in connection with their acquisition of the Czech Republic's CK Fische travel agency. Clifford Chance advised the sellers.N/ACzech Republic
7-MayWeinhold LegalWeinhold Legal advised technology security start-up Resistant AI on its recent venture financing round.N/ACzech RepublicHere
15-MayDentons; PwC LegalPwC Legal advised Varroc Lighting Systems, a Czech manufacturer of headlamps, on the expansion of a syndicate of creditors which had extended the company a EUR 230 million loan. The banking syndicate was advised by Dentons.EUR230millionCzech RepublicHere
21-MayKinstellarKinstellar helped CSOB to launch the we.trade finance platform in the Czech Republic.N/ACzech RepublicHere
21-MayGT Legal; Trojan, Dolecek & PartnersGT Legal represented Fragile Media s.r.e. founder Daniel Kafka and the Etnetera Group at the sale of their combined 50% stake in Fragile Media to the Czech KnowLimits media and communications group. Trojan, Dolecek & Partners advised the buyers on the deal.N/ACzech RepublicHere
22-MayGlatzova & Co; KinstellarGlatzova & Co advised the KKCG investment group on the sale of Conectart, a call center operator in the Czech Republic, to the Genesis Capital Group. The Prague office of Kinstellar advised the buyers on the deal.N/ACzech RepublicHere
25-MayTravers Smith; Weinhold Legal; Wolf TheissWeinhold Legal advised the shareholders of Klikpojisteni.cz, a.s., including the private equity arm of Benson Oak Capital, on the sale of their 100% stake in Klikpojisteni.cz, a.s. to a company majority-owned by TA Associates and minority-owned by MCI EuroVentures. The buyer was advised by Wolf Theiss and Travers Smith.N/ACzech RepublicHere
27-MayAllen & Overy; DentonsDentons advised CPI Property Group on a successful tender offer of bonds and the issue of EUR 750 million 2.75% Notes due 2026 under CPI's EUR 8 billion Medium Term Note Program. Allen & Overy advised joint lead managers Credit Suisse Securities (Europe) Limited, Deutsche Bank AG, HSBC Bank plc, Nomura International plc, and Unicredit Bank AG.EUR750millionCzech RepublicHere
1-JunEversheds Sutherland; Havel & PartnersHavel & Partners advised 2 JCP on the sale of 70% interest in the company to JET 2, an investment fund within the Jet Investment group, which is owned by Igor Fait. The buyer was advised by Eversheds SutherlandN/ACzech Republic
1-JunEversheds Sutherland; White & CaseEversheds Sutherland advised EGAP, the Czech government's export insurer, on its EUR 5 billion COVID-19 rescue program for local companies. White & Case advised the banks.EUR5billionCzech Republic
3-JunGlatzova & CoGlatzova & Co successfully represented the interests of paper products manufacturer Mondi Steti before the Constitutional Court of the Czech Republic.N/ACzech RepublicHere
5-JunKinstellarKinstellar advised US-based Novavax, a late-stage biotechnology company developing next-generation vaccines for serious infectious diseases, on its acquisition of Praha Vaccines a.s. from the Cyrus Poonawalla Group.USD167millionCzech RepublicHere
8-JunDentons; Latham & WatkinsDentons advised Sev.en Energy on the acquisition of US-based metallurgical coal producer Blackhawk Mining. Latham & Watkins advised Blackhawk on the deal.N/ACzech RepublicHere
12-JunKocian Solc BalastikKocian Solc Balastik successfully represented the Czech Republic's National Theatre in a rent dispute before the Czech Supreme Court.N/ACzech RepublicHere
15-JunKocian Solc BalastikKocian Solc Balastik helped prepare contractual documentation for the Arete investment and real estate group related to the refinancing of the portfolio of its EUR 80 million CEE II sub-fund.EUR80millionCzech RepublicHere
16-JunKocian Solc BalastikKocian Solc Balastik advised Czech hosting company Ignum, a member of Slovakias WY Group, on the acquisition of the hosting division of Axfone LLC, a development and telecommunications company with branches in Europe, the USA, and Asia. Solo practitioner Richard Sysel advised Axfone on the deal.N/ACzech RepublicHere
16-JunMasek, Koci, Aujezdsky; Vyskocil Kroslak a PartneriMasek, Koci, Aujezdsky advised sports platform Livesport on the acquisition of film portal Kinobox.cz from entrepreneur Peter Vachler, who will remain on as a consultant. Vyskocil, Kroslak a Partneri advised Vachler on the deal.N/ACzech RepublicHere
17-JunCMS; Dunovska & PartnersCMS advised Arkance on its acquisition of CAD Studio, a company involved in the digitalization of manufacturing and construction industries in the Czech and Slovak Republics and Hungary, from Autocont, a member of the Aricoma Group. Dunovska & Partners advised the sellers on the deal.N/ACzech RepublicHere
1-JulDBK Partners; Havel & PartnersHavel & Partners advised Moufleco Holdings Limited on the the sale of its 45% stake in TEDOM to the CEZ group. DBK Partners advised the buyer.N/ACzech Republic
6-JulKinstellar; Roedl & Partner; Tarpan PartnersKinstellar advised Max Aicher GmbH & Co. KG on the acquisition of the enterprises of bankrupt Czech companies Pilsen Steel s.r.o. and Pilsen Estates s.r.o. from insolvency administrator Jaroslav Broz. Tarpan Partners were on the insolvency administrator's team, while Roedl & Partner served as tax advisors to the Max Aicher group.N/ACzech RepublicHere
8-JulKocian Solc BalastikKSB advised Solitea Holding on the internal merger of thirty companies from the Czech Republic and Slovakia into two national companies.N/ACzech RepublicHere
8-JulKocian Solc BalastikKSB advised Sandberg Capital on the acquisition of a 35% stake in Revolgy Business Solutions.N/ACzech RepublicHere
9-JulWeinhold LegalWeinhold Legal advised Chropynska Strojirna on the acquisition of a 100% stake in HLS Czech.N/ACzech RepublicHere
10-JulAllen & Overy; Go2Law; White & CaseAllen & Overy and Go2Law advised the management of Memsource on the sale of its majority stake to the Carlyle Group. White & Case advised the Carlyle Group.N/ACzech RepublicHere
13-JulClifford ChanceClifford Chance advised the Nadace Dagmar a Vaclava Havlovych VIZE 97 foundation on multiple intellectual property protection matters.N/ACzech RepublicHere
16-JulHavel & Partners; Hengeler Mueller; White & CaseWhite & Case advised Hungary's MVM on the acquisition of the entire share capital in Innogy Czech Republic from Innogy Beteiligungsholding, a member of the Innogy/E.ON Group. Hengeler Mueller and Havel & Partners advised E.ON on the deal.N/ACzech RepublicHere
23-JulHavel & Partners; SchoenherrSchoenherr advised the LYNXCap Group on acquisition of a Czech-originated NPL portfolio and underlying financing from Gorenjska Banka d.d. in Slovenia. Havel & Partners acted as local counsel to Cirilin One a.s.EUR8.8millionCzech Republic
28-JulGrant Thornton; GT Legal; Kocian Solc BalastikKocian Solc Balastik advised the Skoda Transportation Group on the acquisition of Ostrava-based Ekova Electric. GT Legal and Grant Thornton advised the seller, Dopravni Podnik Ostrava.N/ACzech RepublicHere
3-AugAllen & Overy; Clifford ChanceAllen & Overy advised Czech Gas Networks Investments on its successful issuance and placement of EUR 600 million and CZK 6.75 billion notes with investors on international capital markets. Clifford Chance reportedly advised joint book-runners Citigroup Global Markets Europe AG, Societe Generale, UniCredit Bank AG, Ceska Sporitelna, a.s., Ceskoslovenska Obchodni Banka, a. s., and Komercni Banka, a.s., as well as trustee Citicorp Trustee Company Limited and the London branch of Citibank, which acted as the paying agent, transfer agent, and the agent bank.EUR855millionCzech RepublicHere
5-AugBird & BirdBird & Bird advised KB SmartSolutions on its strategic entry into Upvest.N/ACzech RepublicHere
6-AugEversheds Sutherland; HKDW LegalEversheds Sutherland advised Expandia on the sale of the Hamburg Business Center office complex in Pilsen, in the Czech Republic. HKDW Legal advised the buyer.N/ACzech RepublicHere
12-AugHeuking Kuhn Luer Wojtek; Kocian Solc BalastikKocian Solc Balastik and Germany's Heuking Kuhn Luer Wojtek advised China-based Inner Mongolia Mengtai on the acquisition of the Czech part of the Apt group.N/ACzech RepublicHere
19-AugKinstellarKinstellar advised Genesis Growth Equity Fund I on its acquisition of R2B2, an advertising company in the Czech Republic.N/ACzech RepublicHere
2-SepBPV Braun PartnersBPV Braun Partners advised ECO Finance Group s.r.o on establishing a joint venture with the Roman Catholic Archdiocese of Olomouc.N/ACzech RepublicHere
10-SepHavel & PartnersHavel & Partners assisted eMan a.s. with the listing of its CZK 45 million securities on the Prague Stock Exchange's START exchange.CZK45millionCzech RepublicHere
14-SepDLA Piper; NKL LegalDLA Piper's Prague office advised Russia's Trust Union Fund on its acquisition of the Kovosvit machine tool manufacturer from Industry Innovation. NKL Legal advised the sellers on the deal.N/ACzech RepublicHere
14-SepDentons; Weinhold LegalWeinhold Legal advised Etarea Invenium on its acquisition of Pactio DB from the Pactio Invest group. Dentons advised the seller.N/ACzech Republic
17-SepBaker McKenzie; PierstonePierstone advised the Prague-based Socialbakers social media marketing company on the sale of its global business to U.S.-based customer engagement company Astute. Baker McKenzie advised Astute on the deal.N/ACzech RepublicHere
22-SepKocian Solc BalastikKocian Solc Balastik helped the Walteran Company obtain a license from the Czech National Bank to operate an investment company.N/ACzech RepublicHere
22-SepKocian Solc BalastikKSB advised the WY Group on its acquisition of Hosting90 System and Hosting Zdarma in the Czech Republic.N/ACzech RepublicHere
24-SepBaker Mckenzie; JSK; Urban & HejdukBaker McKenzie's Prague office advised Worldline SA/NV on its acquisition of a 53% of stake in Gopay. JSK and Urban & Hejduk advised the seller on the deal.N/ACzech RepublicHere
24-SepKinstellar; White & CaseKinstellar advised Czech investment group Portiva and Micronix on its acquisition of the Central Kladno shopping center in the Czech town of Kladno from Crestyl. White & Case advised Crestyl on the deal.CZK2billionCzech RepublicHere
25-SepDentonsDentons advised CPI Property Group on a successful tender offer and the issue of EUR 525 million 4.875% undated subordinated notes callable in November 2026.EUR525millionCzech RepublicHere
28-SepDLA PiperDLA Piper advised Inven Capital on an unspecified investment in Sweden's Eliq AB.N/ACzech RepublicHere
5-OctKocian Solc BalastikKSB advised Eligo on its acquisition of the Czech branch of Euroserum.N/ACzech RepublicHere
6-OctKocian Solc BalastikKSB advised the Pilsen Public Transport Corporation on awarding a public contract to renovate the Slovany tram depot in the Czech city of Plzen.CZK1.7billionCzech RepublicHere
9-OctHavel & PartnersHavel & Partners advised Prazska Teplarenska on the spin-off of its assets into five successor companies.N/ACzech RepublicHere
9-OctBPV Braun Partners; Schoenherr; Setina Komendova & PartnersSchoenherr advised KB SmartSolutions on the acquisition of an almost 25% stake in Platebni Instituce Roger from Echilon Capital. BPV Braun Partners advised Echilon Capital on the transaction, and Setina, Komendova & Partners advised Platebni Instituce Roger's CEO Adam Soukal and CTO Tomas Slobodnik.N/ACzech RepublicHere
9-OctHavel & PartnersHavel & Partners helped Czech software supplier eMan list its shares on the Start stock exchange.CZK45millionCzech RepublicHere
13-OctJSK; NoerrJSK advised Poland's R22 Group on its acquisition by auction of a 100% stake in ProfiSMS s.r.o. and its two Czech fully-owned subsidiaries, Axima SMS Services s.r.o. and SMSbrana s.r.o., from Net Brokers Holding. Noerr represented the sellers.N/ACzech RepublicHere
13-OctHavel & PartnersHavel & Partners advised on the sale of the Czech special purpose vehicle that owns Prime Timesheet to Icelandic IT company Tempo Ehf.N/ACzech RepublicHere
13-OctHavel & PartnersHavel & Partners advised Genesis Capital Growth on the acquisition of a 100% stake in Home Care Promedica, a home healthcare and social services provider in the Czech Republic.N/ACzech RepublicHere
19-OctClifford Chance; WilsonsClifford Chance advised Generali Real Estate on the acquisition of the IBC office building in Prague from Mint Investments. Wilsons advised Mint Investments.N/ACzech RepublicHere
19-OctHavel & Partners; NoerrNoerr advised Bilfinger SE on the sale of Bilfinger Industrial Services Czech s.r.o., Bilfinger Euromont a.s., and Bilfinger Slovensko s.r.o to funds advised by Deutsche Invest Mittelstand. Havel & Partners advised the buyers on the deal.N/ACzech RepublicHere
19-OctKocian Solc BalastikKocian Solc Balastik advised J&T Banka on project financing to the Julius Meinl Living Group for the development of an apartment hotel on Senovazne Namesti in Prague.EUR27millionCzech RepublicHere
20-OctJSKJSK advised shareholders Petr Janu, Jan Zvonik, Ladislav Partl, and Jiri Trcka on the sale of TKZ Polna, spol. s r.o. to the Rose Investments Group.N/ACzech RepublicHere
20-OctDavis Polk; Novalia; SchoenherrSchoenherr and Davis Polk advised Germany's Celonis on its acquisition of Integromat and its subsidiaries in the Czech Republic. Novalia advised the selling shareholders on the deal.N/ACzech RepublicHere
22-OctHavel & PartnersHavel & Partners, working pro bono, helped the Plant-for-the-Planet organization establish its presence in the Czech Republic.N/ACzech RepublicHere
22-OctKLB LegalKLB Legal advised Pilulka Lekarny on its initial public offering on the Start market of the Prague Stock Exchange. Wood & Company Financial Services served as the arranger on the offering, which was valued at CZK 250 million.CZK250MillionCzech RepublicHere
27-OctDentons; SkilsDentons advised international energy group Sev.en Energy on the acquisition of the Pocerady power plant from CEZ. Skils advised CEZ on the transaction.N/ACzech RepublicHere
27-OctClifford ChanceClifford Chance advised AOC on its acquisition of the unsaturated polyester resin manufacturing operations of Spolchemie.N/ACzech RepublicHere
27-OctEversheds Sutherland; Kastner GravelleEversheds Sutherland advised construction management software provider Procore Technologies on Czech aspects of its acquisition of Esticom, a cloud-based estimating and take-off solution provider and preconstruction technology provider. Kastner Gravelle advised on US Law.N/ACzech Republic
30-OctPRK PartnersPRK Partners advised International Campus Group on the completion of a first-of-its-kind student campus in Prague.N/ACzech Republic
31-OctHavel & Partners; White CaseHavel & Partners advised Innogy SE on the sale of a 50.04% stake in innogy Grid Holding a.s, a Czech gas distribution network, to RWE. White & Case advised the buyer.N/ACzech Republic
3-NovBird & BirdBird & Bird assisted KB SmartSolutions on an unspecified investment into the fintech company Lemonero, made through the acquisition of shares in its parent company, MonkeyData.N/ACzech RepublicHere
3-NovAllen & Overy; White & CaseAllen & Overy advised Ceska Zbrojovka Group on its initial public offering and the listing of its shares on the Prime Market of the Prague Stock Exchange. White & Case advised joint global coordinators and joint bookrunners Ceska Sporitelna, Komercni Banka, and Societe Generale.CZK812millionCzech RepublicHere
5-NovKocian Solc BalastikKSB successfully represented Czech railway carrier Leo Express in a complaint against competitor Ceske Drahy filed with the European Commision.N/ACzech RepublicHere
5-NovKinstellarKinstellar helped Nexen Tire Europe lease a 12,000-square-meter warehouse in CTPark Zatec, about 80 kilometers northwest of Prague, from CTP Bohemia North.N/ACzech RepublicHere
5-NovClifford ChanceClifford Chance advised sole lead manager J&T Banka and arranger J&T IB Capital Markets on Energo-Pro Green Finance's issuance of bonds valued at CZK 530 million.CZK530millionCzech RepublicHere
6-NovKocian Solc Balastik; PRK PartnersPRK Partners advised Euroserum on the sale of its international operations to Eligo. Kocian Solc Balastik reportedly advised Eligo.N/ACzech RepublicHere
11-NovKinstellarKinstellar advised Veolia on its acquisition of Prazska Teplarenska from EP Energy, a subsidiary of the EPH Group.N/ACzech RepublicHere
11-NovBaroch Sobota; SchoenherrThe Czech office of Schoenherr advised the Auto Palace Group, a Czech subsidiary of the Dutch AutoBinck Group, on the acquisition of car dealerships in Prague and Karlovy Vary from CarPoint Karlovy Vary s.r.o., which was advised by Baroch Sobota.EUR6millionCzech RepublicHere
16-NovForlex; KinstellarKinstellar advised Kemp Technologies on its acquisition of Czech Republic-based Flowmon. Forlex advised the unidentified sellers.N/ACzech RepublicHere
25-NovGlatzova & Co; HKRGlatzova & Co advised Bike Fun Nederland B.V. on the sale of Bike Fun International, a company based in the Czech city of Koprivnice, to ConsilTech. HKR advised ConsilTech on the deal.N/ACzech RepublicHere
27-NovBPV Braun Partners; Svec RychterovaBPV Braun Partners advised Generali Investments CEE, an investment company acting on behalf of the Generali Real Estate Fund, on the acquisition of an early 20th-century building in Prague from Ferd s.r.o. Ferd was advised by the Svec Rychterova law firm.N/ACzech RepublicHere
27-NovKocian Solc BalastikKocian Solc Balastik advised ING Bank Slaski on financing to an unidentified borrower for the acquisition of two LET Aircraft Industries L-410 UVP E-20 aircrafts.N/ACzech RepublicHere
1-DecKocian Solc Balastik; NoerrNoerr assisted ALSO Holding AG on its acquisition of Daquas, a Cloud Solution Provider for Microsoft from the Droege Group. The seller was advised by Kocian Solc Balastik.N/ACzech Republic
9-DecAllen & Overy; DentonsDentons advised the CPI Property Group on its new five-year term EUR 700 million revolving credit facility with Banco Santander, Barclays, Credit Suisse, Goldman Sachs, HSBC, J.P. Morgan, Komercni Banka, Raiffeisen Bank AG, UniCredit, and Bank of China. Allen & Overy's London office advised the banks on the deal.EUR700millionCzech RepublicHere
15-DecDentonsDentons successfully represented Veolia Energie CR in a dispute with Czech tax authorities regarding interest from illegal gift tax.N/ACzech RepublicHere
16-DecGlatzova & Co.; Rutland PartnersGlatzova & Co. advised Raiffeisenbank on its provision of a CZK 215 million loan to BesTen. Rutland Partners advised the borrower on the deal.CZK215millionCzech RepublicHere
16-DecGlatzova & Co.Glatzova & Co. helped Smartlook.com obtain a CZK 81 million Series A investment from Dutch investment company Airbridge Equity Partners and other unidentified investors.CZK81millionCzech RepublicHere
23-DecGlatzova & CoGlatzova & Co advised Reflex Capital on the sale of its stake in Brno startup Webnode to the Belgian company Team.Blue.N/ACzech RepublicHere
23-DecKocian Solc BalastikKocian Solc Balastik advised Arete Invest's real-estate fund on the EUR 113 million sale of a portfolio of 11 logistics and industrial parks in the Czech Republic and Slovakia to Australia-based fund Cromwell.EUR113millionCzech RepublicHere
23-DecPRK PartnersPRK Partners and NautaDutilh advised CD Cargo on the successful acquisition of a CZK 3.43 billion loan from the European Investment Bank.CZK3.43billionCzech Republic
24-DecAK Evan; Clifford ChanceClifford Chance advised Corporate Finance House Group on a joint acquisition with Ceskomoravska Nemovitostni of the Churchill Square office from Penta Real Estate. AK Evan advised Penta Real Estate on the deal.CZK4billionCzech RepublicHere
28-DecClifford Chance; Kocian Solc BalastikKocian Solc Balastik advised J&T Banka on its CZK 2.1 billion acquisition of Rustonka Development II, which owns the Rustonka office building in Karlin, Prague. Clifford Chance advised the sellers on the deal.CZK2.1billionCzech RepublicHere
29-DecBpv Braun Partners; KinstellarBPV Braun Partners advised Immofinanz on the acquisition of retail parks in the Czech town of Litvinov and the Horni Mecholupy neighborhood of Prague from Mitiska Reim. Kinstellar advised Mitiska Reim on the deal.N/ACzech RepublicHere
29-DecNovalia; SchoenherrSchoenherr advised Beijer Ref AG on the acquisition of a majority stake in Czech Sinclair Global Group s.r.o. from private individuals Ivo Nespor, Vladimir Pakosta, and Zdenek Cizek. Novalia advised the sellers on the deal.N/ACzech RepublicHere
31-DecPRK PartnersPRK Partners advised a syndicate of ING Bank, Ceska Sporitelna, and Hypo Noe Gruppe Bank AG on project financing for an underground gas storage facility in Damborice, in the Czech Republic.N/ACzech Republic
22-OctNoerr; Vyskocil Kroslak & PartneriNoerr advised Kuka AG, a manufacturer of industrial robots, production machines, and systems, on the closure and disposal of a manufacturing plant in Northern Bohemia. Vyskocil Kroslak & Partneri advised the buyer.N/ACzech Republic
2-JanLakatos, Koves & Partners; SzecskayLKT assisted Cad Studio s.r.o., the Czech distributor of Autodesk, on its purchase of the Autodesk distribution business of Varinex. The sellers were advised by Szecskay.EUR2millionCzech Republic; Hungary
17-SepCMS; SchoenherrSchoenherr advised Covivio on its lease of the Carlo IV hotel in Prague and the New York Palace and New York Residence hotels in Budapest to the NH Hotel Group. CMS advised the NH Hotel Group on the deal.N/ACzech Republic; HungaryHere
22-SepCastren & Snellman; DLK Legal; Havel & Partners; Kinstellar; Osborne Clarke; SorainenDLK Legal in Poland and Kinstellar in Hungary and the Czech Republic advised Infosys on its acquisition of GuideVision. Osborne Clarke, Sorainen, and Castren & Snellman also advised Infosys on the deal. Havel & Partners served as GuideVision's advisor in the Czech Republic.EUR30millionCzech Republic; Hungary; PolandHere
19-MarAllen & Overy; Greenberg Traurig; Kinstellar; Kirkland & EllisGreenberg Traurig provided Polish advice to GLP on its acquisition of Goodman Group's Central and Eastern Europe logistics portfolio. Kirkland & Ellis served as global legal counsel to GLP, while Kinstellar provided local legal advice with respect to Czech, Slovak, and Hungarian aspects of the transaction. Allen & Overy advised the Goodman Group on the deal.EUR1billionCzech Republic; Hungary; Poland; SlovakiaHere
16-DecJadek & Pensa; SchoenherrSchoenher advised EP Logistics International, a.s on its acquisition of a 49% stake in SZ-Tovorni Promet d.o.o., a Slovenia-based company engaged in providing rail cargo services, and Fersped AD Skopje, a Macedonia-based company from Slovenian Railways Ltd. Fersped AD was advised by Jadek & Pensa.EUR60millionCzech Republic; North Macedonia; Slovenia
9-SepDLA Piper; Havel & Partners; SchoenherrSchoenherr advised Twisto Payments a.s. on the increase of share capital by existing and new investors. DLA Piper and Havel & Partners advised the investors - ZIP Co Ltd and Elevator Ventures.EUR6.1millionCzech Republic; Poland
22-DecHavel & Partners; SchoenherrHavel & Partners advised Elevator Ventures Beteligungs GmbH on its acquisition of a 2.34% stake in Twisto Payments a.s. Schoenherr advised the seller.N/ACzech Republic; Poland
28-DecBaker MckenzieBaker McKenzie advised Energeticky a Prumyslovy Holding on the sale of 38.946% of the shares and Braindour Development Limited on the sale of 61.029% of the shares in Polish coal mine Przedsiebiorstwo Gornicze Silesia to Bumech.N/ACzech Republic; PolandHere
14-FebCMS; Dentons; LegesLawyers from CMS in Ukraine and Poland joined the firm's multi-national team advising the EBRD on the acquisition of a stake in Uzbek food retailer Korzinka. Uzbek law firm Leges reportedly advised the EBRD as well, while Dentons advised the sellers.USD40millionCzech Republic; Poland; Russia; UkraineHere
14-FebClifford Chance; Go2Law; SchoenherrSchoenherr and Hugh Owen of Go2Law advised UNIQA on its acquisition of AXA subsidiaries in the Czech Republic, Poland, and Slovakia. Clifford Chance advised AXA on the transaction.EUR1billionCzech Republic; Poland; SlovakiaHere
26-AugGarrigues; Studnicki, Pleszka, Cwiakalski, GorskiStudnicki, Pleszka, Cwiakalski, Gorski advised the Oriens Bijou Group on the sale of the network to the Tous group. Garrigues advised Tous on the deal.N/ACzech Republic; Poland; SlovakiaHere
1-JanBondoc & AsociatiiBondoc si Asociatii assisted the Generali Group on the restructuring of its pension funds management activities in Romania.N/ACzech Republic; Romania
20-FebDentons; Rodl & PartnerDentons advised GeoPost / DPDgroup on the acquisition of Czech and Slovak parcel delivery operations of Germany's Geis logistics group. The Geis group was advised by Rodl & Partner.N/ACzech Republic; SlovakiaHere
28-FebBadokh; CMS; SchoenherrSchoenherr advised Kommunalkredit Austria AG on financing provided to Enery Development for its acquisition of six 21 MW solar power plants in the Czech Republic and two 4 MW solar power plants in the Slovak Republic from Czech fund Green Horizon Renewables. CMS advised Enery and Badokh advised Green Horizon Renewables.N/ACzech Republic; SlovakiaHere
31-MarWhite & CaseWhite & Case advised TPG Capital on a development loan for unidentified industrial premises to "serve as multi-purpose facilities for warehousing, administration, and trade and science and technology."N/ACzech Republic; SlovakiaHere
22-JunHavel & Partners; Majernik & MihalikovaMajernik & Mihalikova advised two shareholders of NG Aviation, a start-up developing a platform for digitizing aeronautical data, on the sale of some of their shares. Havel & Partners advised the unidentified buyer.N/ACzech Republic; Slovakia
3-JulAllen & Overy; Clifford ChanceClifford Chance advised Vseobecna Uverova Banka a.s., the Slovak subsidiary of Intesa Sanpaolo, on the update of its EUR 5 billion covered bond program and another syndicated EUR 500 million issuance via the Luxembourg Stock Exchange. Allen & Overy advised joint lead managers Banca IMI S.p.A., Commerzbank Aktiengesellschaft, Danske Bank A/S, Erste Group Bank AG, and Landesbank Baden-Wuerttemberg.N/ACzech Republic; SlovakiaHere
6-AugBlockchain Legal; Majernik & MihalikovaMajernik & Mihalikova, as Slovak law advisor, and Blockchain Legal, as Czech law advisor, assisted Citadelo and its shareholders on a number of transfers of the shareholdings in the Slovak and Czech entity among the founders and to Swizterland's Artmotion, which became a majority shareholder in both entities.N/ACzech Republic; Slovakia
18-NovHamala Kluch Viglasky; Havel & PartnersHavel & Partners advised Austria's Innofreight Consulting & Logistics on the formation of a joint venture with Slovakia's Budamar Logistics. Hamala Kluch Viglasky advised Budamar Logistics on the deal.N/ACzech Republic; SlovakiaHere
3-JanPWC LegalPWC Legal advised DncOne OU, managed by Estonian entrepreneur Ullar Jaaksoo, on its acquisition of iD Susteemide OU.N/AEstoniaHere
17-JanTarkTark successfully represented Solaris Bus & Coach in a dispute over the procurement of gas buses for Tallinna Linnatranspordi.N/AEstoniaHere
17-JanSorainenSorainen successfully represented Eesti Kontsert, a state-owned philharmonic foundation, in a dispute against claimants United Capital and Brutus Inkasso.EUR28296EstoniaHere
20-JanLeadell (Pilv)The Leadell Pilv firm successfully defended businessman Alexander Kofkin in the Harju County Court.N/AEstoniaHere
21-JanSorainen; TrinitiTriniti advised ANMKinnisvara, K.E.D.S, and Faroc on the sale of Birger to Finland's Fincumet Group, which was advised by Sorainen.N/AEstoniaHere
22-JanCobalt; SorainenCobalt advised the European Investment Bank on a EUR 50 million venture debt facility to Bolt, the Estonian developer of a ride-hailing app. The borrowers were advised by Sorainen on the financing.EUR50millionEstoniaHere
27-JanCobalt; Ellex (Raidla); NoveCobalt advised and represented AS Ragn-Sells in a complex insurance dispute with Seesam Insurance regarding the fires in Ragn-Sells' MBT-plant in Tallinn. Nove and Ellex Raidla advised Seesam.N/AEstonia
28-JanTGS BalticTGS Baltic advised real estate company KEK Arendus OU, a member of the Rondam Group, on its acquisition of an office building in the Tallinn city center from Danske Bank A/S and on its conclusion of a lease contract with the current user of the building.N/AEstoniaHere
29-JanCobaltCobalt advised AS PRFoods, a fish farming and production company listed on the Tallinn Stock Exchange, on a private placement of secured notes.EUR9.1millionEstoniaHere
31-JanEllex (Raidla); PwC LegalPwC Legal Estonia advised DncOne OU on its acquisition of iD Susteemide OU. Ellex Raidla advised the sellers.N/AEstoniaHere
31-JanSorainenSorainen advised the Fincumet Group on the acquisition of a 60% stake of Estonia's Birger, a producer of hooklift containers and related steel constructions, from owner and CEO Aleksei Manniste.N/AEstoniaHere
5-FebHPP Attorneys; Pohla & HallmagiEstonia's Pohla & Hallmagi advised Wraight Invest on its acquisition of the remaining 54% of Hobby Hall Group OU from fellow shareholders SGN Group Oy and Four P&P Consulting Oy. Finland's HPP Attorneys advised the Finnish sellers on the deal.N/AEstoniaHere
5-FebCobaltCobalt advised Poco Holding on the sale of banking-as-a-service provider PocoSys to the Opera Group. Opera also signed an agreement to acquire PocoSys's sister company, EU-licensed payment institution Pocopay.N/AEstoniaHere
12-FebGlikman Alvin LevinGlikman Alvin Levin advised Deca Games OU on its merger with Deca Live Operations GmbH.N/AEstoniaHere
19-FebCobaltCobalt advised Change Ventures on its EUR 500,000 investment in Estonian educational startup 99math.EUR500000EstoniaHere
21-FebCobaltGide advised B&B Hotels Polska on a cooperation agreement with Covivio and on the sale and leaseback of three hotels. Covivio was advised by Wardynski & Partners.N/AEstoniaHere
28-FebNjordNjord represented RedDigital OU on its entrance into a sponsorship deal with Watford FC for the Sportsbet.io brand. Australia's KKI law firm advised Watford.GBP6millionEstonia
5-MarCobaltCobalt advised Laurus S.a.r.l. on the sale of the Valge Maja office building in Tallinn to LHV pension funds.N/AEstoniaHere
5-MarCobaltCobalt successfully helped Nuctech Warsaw Company Limited Sp. z o.o. win a public procurement procedure to sell the Tallinn Airport two baggage-scanning devices.N/AEstoniaHere
17-MarCobaltCobalt advised Luminor Bank on its inaugural issue of covered bonds, with an aggregate nominal value of EUR 500 million.EUR500millionEstoniaHere
27-MarPohla & HallmagiPohla & Hallmagi advised the Hobby Hall Group, operating under the Hansapost brand, on an agreement to manufacture and provide personal protective equipment to the seven clinics of the North Estonia Medical Center.N/AEstonia
27-MarCobaltCobalt advised SA KredEx on conducting a public procurement in 2020 for the development of the Estonian start-up business ecosystem and start-up business development programs.N/AEstonia
30-MarCobaltCobalt successfully represented Estonia's largest waste handler Ragn-Sells AS in a dispute regarding the public procurement of a waste removal concession organized by the Vinni municipality in northern Estonia.N/AEstoniaHere
2-AprCobaltCobalt advised fashion brand house AS Baltika on reorganization proceedings.N/AEstoniaHere
7-AprBorenius; Cobalt; Ellex (Raidla); Ideal AdvokatfirmaCobalt and Ideal advised Denmark's DA Agravis Machinery Holding A/S on acquiring the remaining 55% of the shares in AS Konekesko Eesti, a company selling agricultural machinery. Borenius and Ellex Raidla advised the seller.N/AEstonia
16-AprPwC LegalPwC Legal successfully represented Guardtime in a public procurement dispute before the Public Procurement Review Committee and Tallinn Administrative Court, which allowed Guardtime to enter into a public procurement agreement with NATO to develop an automated planning and control platform for the NATO Cyber Range.N/AEstoniaHere
16-AprSorainenSorainen advised Tenova India Private, an international innovative solutions provider for metals and mining, in an asset recovery process.N/AEstoniaHere
17-AprCobalt; Eversheds SutherlandEversheds Sutherland Ots & Co Managing Partner Maivi Ots been designated the reorganization adviser for proceedings related to AS Tallinna Moekombinaat, the owner and administrator of the T1 Mall of Tallinn, advised by Cobalt.N/AEstoniaHere
20-AprDerling Primus; TGS BalticTGS Baltic advised AS Framm on the acquisition of AS Lasbet Tootmine from AS Lasbet. Derling Primus advised AS Lasbet on the deal.N/AEstoniaHere
20-AprSorainenSorainen advised Auth0 on its acquisition of Apility.io.N/AEstoniaHere
21-AprCobaltCobalt advised Steel Import Finland Oy, a metal products wholesaler, on the acquisition of Estonia's Osauhing FinEst Metallid.N/AEstoniaHere
23-AprCobalt; Ideal Advokatfirma; Njord; Trust OYCobalt, working alongside Ideal Advokatfirma, advised Baltic Agro Machinery OU on the sale of John Deere's agricultural and horticultural machinery business in Estonia to Wihuri OU. Njord and Trust OY advised the buyer.N/AEstoniaHere
24-AprCobaltCobalt's Tallinn office successfully represented Starbucks Corporation in a dispute involving a local entrepreneur's attempt to register a confusingly similar trademark.N/AEstoniaHere
30-AprNjord; WistrandNjord consulted Vereeni Investments Ltd on its investment in Sweden's Flax Innovations. Flax was advised by the Swedish firm Wistrand.EUR0.5millionEstonia
1-MayGlimstedt; TGS BalticTGS Baltic advised SIA Mailigen on the sale of its mailing business to Estonian company Pipedrive. Glimstedt advised the buyer.N/AEstonia
7-MayFortFort Legal advised AS Selver, a subsidiary of Tallinna Kaubamaja Grupp AS, on its acquisition of a 100% shareholding in retailer ABC Supermarkets AS.N/AEstoniaHere
7-MaySorainenSorainen represented Tallinna Linnatranspordi Aktsiaselts, a company fully owned by the City of Tallinn, in its purchase of compressed gas for natural gas-powered buses.N/AEstoniaHere
18-MayCobaltCobalt advised Change Ventures on its investment in fintech startup askRobin.N/AEstoniaHere
18-MaySorainenSorainen assisted SeAH Changwon Integrated Special Steel Corporation with an asset recovery process.N/AEstoniaHere
26-MayEllex (Raidla)Ellex Raidla advised NGO Back to Work on testing one of the world's first digital immunity passports - an application that enables users to securely share data when a person taken a COVID-19 virus test or an antibody test.N/AEstoniaHere
26-MayCobaltCobalt advised AS LHV Pank, an Estonian credit institution with shares are listed on the Tallinn Stock Exchange, on the establishment of its EUR 1 billion Covered Bond Program.EUR1billionEstoniaHere
29-MaySorainenSorainen successfully represented the Polybius Foundation, which had conducted an initial coin offering, in a dispute involving one of the buyers, Maksim Velitsko, who was attempting to force a reversal of his token purchase.N/AEstoniaHere
29-MayCederwalls; Cobalt; Krogerus; Njord; RoschierNjord, working with lead advisor Roschier in Sweden and Krogerus as advisor in Finland, advised the Sveafastigheter Fersen AB real estate fund on a cross-border reinvestment transaction. Cederwalls and Cobalt advised Nordea Bank.N/AEstonia
29-MayNjordNjord advised CoinField Ventures OU on the start of Sologenic IEO -- the first project to utilize the XRP Ledger for tokenizing stocks and ETFs.USD2MillionEstonia
2-JunCobaltCobalt advised Nordea Bank Abp on amendments to a EUR 280 million loan agreement with AS Tallink Grupp, an Estonian shipping company, that was signed in 2016.EUR280millionEstoniaHere
3-JunSorainenSorainen advised transportation platform Bolt on a EUR 100 million investment from London-based investment firm Naya Capital Management.EUR100millionEstoniaHere
3-JunEllex (Raidla)Ellex Raidla advised the European Investment Bank on a EUR 25 million loan to the North Estonia Medical Centre.EUR25millionEstoniaHere
8-JunTGS BalticTGS Baltic advised Iron Mountain Inc. on the applicable time limits for the preservation of documents and obligations regarding the submission of documents to public authorities.N/AEstoniaHere
15-JunSorainenSorainen Estonia advised Communications & Power Industries on the acquisition of SATCOM Technologies, the antenna systems business of General Dynamics.N/AEstoniaHere
15-JunFortFort's Estonia office advised AS LHV Pank, a subsidiary of AS LHV Group, on its acquisition of Danske Bank's business unit operating the Estonian corporate and public sector credits, which at the end of April amounted to approximately EUR 312 million.EUR312millionEstoniaHere
15-JunSorainenSorainen advised the Estonian technology company Milrem Robotics on raising EUR 5.5 million from a number of prominent Estonian investors.EUR5.5millionEstoniaHere
16-JunSorainenSorainen advised Livonia Partners on the sale of a majority stake in Thermory, a producer of thermally modified wood and sauna materials, to Estonian capital-based UG Investeeringud, which as a result transforms from a minority to a majority shareholder.N/AEstoniaHere
16-JunCobalt; SchjodtCobalt advised the Algeco Group on its acquisition of Wexus Group AS from Norvestor Equity AS. Norway's Schjodt law firm advised the sellers.N/AEstoniaHere
16-JunSorainenSorainen advised the Fortum Corporation on the acquisition by subsidiary Fortum Heat Estonia of the remaining 40% in district heating and cooling group Fortum Tartu from Giga.N/AEstoniaHere
16-JunTGS BalticActing on behalf of Erial Ehitus OU, TGS Baltic successfully persuaded the Supreme Court of Estonia to overrule lower courts' rulings that the company's name could not be registered because the word "construction" ("ehitus," in Estonian) in its name was protected as a trademark.N/AEstoniaHere
19-JunTrinitiTriniti successfully persuaded the Tallinn Circuit Court of Appeal to uphold the judgment of the District Court in a dispute between Estonian individual Katrin Lust and prominent chiropractor and entertainer Allan Gary Oolo involving an episode of the Estonian TV show Kuuuurija.N/AEstoniaHere
23-JunSorainenSorainen advised EIB on financing a project related to the modernization of tracks and signaling and traffic control systems of Estonian Railways.EUR95millionEstoniaHere
26-JunCobaltCobalt advised AS Baltika on reorganization proceedings.N/AEstoniaHere
26-JunCobaltCobalt helped Luminor Bank request the termination of the reorganization proceedings of dumpling producer Uvic.EUR9millionEstoniaHere
26-JunCobalt; Ellex (Raidla); SorainenCobalt advised Fortumo and Ellex Raidla advised the company's founders and shareholders Mobi Solutions, Rain Rannu and Veljo Otsason on the sale of Fortumo to global mobile payments platform Boku. Sorainen advised Boku on the deal.USD45millionEstoniaHere
1-JulCobalt; Hedman PartnersCobalt advised Change Ventures on a seed investment into Planet42. Hedman Partners reportedly advised Planet42.EUR2.2millionEstoniaHere
8-JulCobaltCobalt advised Berlin-based early-stage investor Project A on its investment in Estonian start-up Pactum, an AI-based platform that enables global companies to automate personalized commercial negotiations on a massive scale.N/AEstoniaHere
8-JulCobalt; FortCobalt advised Laurus - a joint venture of Partners Group and Northern Horizon Capital - on the sale of the building housing SEB's head office in Tallinn to East Capital Real Estate IV. Fort Legal advised the buyer on the transaction.EUR45.75millionEstoniaHere
21-JulCobaltCobalt helped the Estonian Ministry of Economic Affairs and Communications obtain authorization to provide State aid from the European Commission.EUR20millionEstoniaHere
23-JulEllex (Raidla)Ellex Raidla successfully represented Enefit Green in a dispute over competition clearance the company received for its 2018 merger with Nelja Energia AS.N/AEstoniaHere
3-AugSorainenSorainen advised Montonio on its generation of EUR 500,000 from both Estonian and international investors.EUR500000EstoniaHere
5-AugCobaltCobalt advised Estonia-based real estate development and management company Capfield OU on a EUR 85 million financing it received from Luminor.EUR85millionEstoniaHere
7-AugCobaltCobalt advised Estonia's Helmes on its acquisition of all shares of software development company T2T from Latvia's Tet.N/AEstoniaHere
11-AugCobaltCobalt advised the Rubylight technology investment fund on its participation in Tandem's Series A round of financing, which also included investors Brighteye Ventures, Trind Ventures, and GPS Ventures.USD5.7millionEstoniaHere
2-SepPwC LegalPwC Legal advised GuardTime on its entrance into a partnership with the Estonian Ministry of Interior's IT and Development Centre.N/AEstoniaHere
2-SepTGS BalticTGS Baltic successfully represented the interests of Kuu HUBB Oy in a dispute in the Arbitration Court of the Estonian Chamber of Commerce and Industry.N/AEstoniaHere
7-SepEversheds Sutherland; SorainenEversheds Sutherland in Estonia advised UP Invest on its EUR 65 million acquisition of Forum Cinemas from AMC. Sorainen advised AMC on the deal.EUR65millionEstoniaHere
14-SepSorainenSorainen advised Sunly City on the implementation of a new business model for electricity consumers, and on developing and drafting customer contracts for solar energy solutions.N/AEstoniaHere
2-OctNoveThe Nove Law Firm successfully represented the Political Party Financing Supervision Committee in a dispute with the Center Party of Estonia.EUR40387EstoniaHere
6-OctEllex (Raidla)Ellex Raidla advised the LHV Group on the public offering of its EUR 25 million subordinated bonds.EUR85.3millionEstoniaHere
12-OctCobaltCobalt successfully represented textile solutions supplier Protex Balti AS in a dispute with Amigtex, the vendor of Optitex software.N/AEstoniaHere
13-OctCobaltCobalt successfully represented Protex Balti in a dispute with Amigtex.N/AEstoniaHere
28-OctEversheds Sutherland; SorainenSorainen advised Splunk Inc., a US-based global provider of the Data-to-Everything Platform, on the acquisition of Estonian tech startup Plumbr. Eversheds Sutherland advised Plumbr's selling shareholders on the deal.N/AEstoniaHere
2-NovSorainenSorainen advised Metsagrupp on its entrance into a joint venture with Sunly Land.N/AEstoniaHere
3-NovSorainenSorainen advised Northern Horizon Capital on a secondary public offering that raised EUR 7.2 million and a listing of new units of the Baltic Horizon Fund on Nasdaq Tallinn and Nasdaq Stockholm stock exchanges.EUR7.2millionEstoniaHere
6-NovEllex (Raidla)Ellex Raidla helped Skeleton Technologies Group raise EUR 41.3 million in a funding round from a group of investors, including EIT InnoEnergy, FirstFloor Capital, MM Group, and Harju Elekter.EUR41.3millionEstoniaHere
10-NovCobalt; Hedman PartnersCobalt advised Passion Capital on its USD 1.4 million seed-round investment into Warren.io. Hedman Partners advised Warren.io on the deal.USD1.4millionEstoniaHere
13-NovCobaltCobalt advised Ambient Sound Investments and other shareholders on the sale of InBio to Semetron.N/AEstoniaHere
16-NovCobaltThe Riga office of Cobalt helped 3Commas raise USD 3 million in series A funding from Alameda Research.USD3millionEstoniaHere
16-NovCobalt; Ellex (Raidla)Cobalt advised Estonian energy group Alexela on its receipt of a EUR 37 million loan from Sihtasutus KredEx, a financing institution established by the Estonian Ministry of Economic Affairs and Communications. Ellex Raidla advised KredEx on the deal.EUR37MillionEstoniaHere
17-NovAvance Attorneys; CobaltThe Tallinn office of Cobalt advised French private investment house Ardian on its acquisition of 100% of Nevel Oy from Vapo Oy. Vapo was advised by Finland's Avance Attorneys.N/AEstoniaHere
18-NovSorainenSorainen advised Fenestra on its acquisition of Kuopion Rakennuskonttori, a Finnish provider of window installation services.N/AEstoniaHere
18-NovHedman PartnersHedman Partners become Solaride's legal advisor on its project to build a solar-powered car in Estonia.N/AEstoniaHere
23-NovCobalt; Pohla & HallmagiPohla & Hallmagi advised F&A Kinnisvara, a member of the Favorite Group, on its acquisition of a residential development project near Tallinn. The unidentified sellers were advised by Cobalt.N/AEstoniaHere
23-NovCobaltCobalt successfully represented Helmes, an international custom software developer, in disputes regarding the public procurement process for "Development and Maintenance Services for Collection App Software" organized by Estonia's Information Technology Center of the Ministry of Finance.EUR1.25millionEstoniaHere
23-NovEllex (Raidla); Pohla & HallmagiPohla & Hallmagi helped Verston Ehitus acquire Estonia's state-owned road maintenance company AS Eesti Teed at public auction. Ellex Raidla advised the Ministry of Economic Affairs and Communications on the auction.EUR19.7millionEstoniaHere
23-NovNjord; TGS BalticNjord assisted Kirkcong Property OU with the development and maintenance of the Heathmont Group's new office building in Tallinn. TGS Baltic advised the seller.EUR8millionEstonia
25-NovHedman Partners; Morgan Lewis & Bockius; TGS BalticTGS Baltic advised Gan Limited on the acquisition of the Coolbet online gaming platform from the Vincent Group. Hedman Partners and Morgan, Lewis & Bockius advised the Vincent Group on the deal.N/AEstoniaHere
27-NovFortFort Legal advised LHV Pension Funds on the acquisition of three stock office-type commercial buildings in Juri in the Rae municipality of Estonia.N/AEstoniaHere
27-NovPohla & HallmagiPohla & Hallmagi advised Arca Varahaldus on its EUR 6.2 million sale of property in Tallinn to EfTEN Real Estate Fund III AS subsidiary EfTEN SPV19 OU.N/AEstoniaHere
27-NovEllex (Raidla)Ellex Raidla advised the 1more Project on its EUR 21 million acquisition of two buildings in Tallinn from Hammerhead.EUR21millionEstoniaHere
27-NovNjordNjord assisted Imepilt AS with its IPO on the First North growth market, with LHV Bank.EUR1.5millionEstonia
1-DecSorainenSorainen successfully represented Estonian meat producer Atria in its dispute with the Estonian Veterinary and Food Board.N/AEstoniaHere
2-DecSorainenSorainen and Sweden's Vinge Law Firm advised Swedish industrial group Hexatronic on the acquisition of Estonia-based Baltronic and Canada-based Toronics.N/AEstoniaHere
11-DecCobaltCobalt advised AS Ekspress Grup, on the conclusion of an employee share option program and the setting up of a new option program.N/AEstoniaHere
15-DecEllex (Raidla); SorainenSorainen's Tallinn office advised Sunly Land on the issuance of its EUR 14 million bonds, which are to be invested in by Estonia's LHV pension funds. Ellex Raidla advised LHV on the deal.EUR14millionEstoniaHere
16-DecCobaltCobalt advised the shareholders of MCF Group Estonia OU on the sale of the company to Greenergy Data Centers.N/AEstoniaHere
16-DecPohla & HallmagiPohla & Hallmagi helped the E-Governance Academy establish a joint venture with Japan's Mitsubishi UFJ Research and Consulting.N/AEstoniaHere
16-DecCobalt; Ellex (Raidla)Cobalt advised Estonian fintech company Modularbank on raising EUR 4 million of late seed funding. The round was led by Karma Ventures and BlackFin Capital Partners, with additional support from Plug and Play Ventures, Siena Capital, and angel investor Ott Kaukver. Ellex advised Karma Ventures and BlackFin Capital Partners on the transaction.EUR4millionEstoniaHere
18-DecEllex (Raidla)Ellec Raidla helped the Council of the University of Tartu establish UniTartu Ventures - a way to direct the intellectual property created by UT researchers to research-and-technology-intensive companies.N/AEstoniaHere
18-DecPohla & HallmagiPohla & Hallmagi advised Estonian vehicle rental company Mobire Group OU on the sale of a 53% stake to Inbank.N/AEstoniaHere
18-DecNjordNjord assisted Japanese corporation MBK Co., Ltd., and its Estonian subsidiary Estonian Japan Trading Company AS, on its structural establishment and IPO on the First North growth market.N/AEstonia
21-DecCobaltCobalt successfully represented the Havas marketing communications agency in a dispute with Alfa-Omega Communications regarding the results of a public procurement process organized by Enterprise Estonia.N/AEstoniaHere
21-DecOrrick; SorainenSorainen advised Estonian mobility platform Bolt on a EUR 150 million funding round. The investment was led by D1 Capital Partners, with the participation of Darsana Capital Partners. Orrick advised Darsana Capital Partners on its participation in the funding round.EUR150millionEstoniaHere
23-DecPwC LegalPWC Legal's successfully represented the Estonian Authors' Society, the Estonian Association of the Phonogram Producers, the Estonian Performers' Association, the Estonian Association of Audiovisual Authors, the Estonian Composers' Union, the Association of Estonian Professional Musicians, the Estonian Directors' and Dramaturgs' Union, the Estonian Association of Stage Performers, and the Association of Professional Actors of Estonia in a dispute regarding compensation for the reproduction of original works.EUR3.5millionEstoniaHere
24-DecSorainenSorainen advised the Saunum Group on the initial public offering of its shares and their admission to trading on the First North alternative market, operated by Nasdaq Tallinn.EUR500000EstoniaHere
28-DecTGS BalticTGS Baltic advised Nikolai Russakov, the owner of the AS Kroodi Terminal fuel terminal and MK Kamion OU fuel wholesaler, on the sale of the two companies to Terminal Oil OU.N/AEstoniaHere
29-DecEllex (Raidla); PwC LegalEllex Raidla advised the BaltCap Growth Fund on an acquisition of a majority stake in Tradehouse from founders Avo and Angela Kivimaa. PwC Legal advised the sellers.N/AEstoniaHere
29-DecDLA Piper; SorainenSorainen, working with DLA Piper, advised paints producer PPG on a voluntary recommended public cash tender offer for all the shares in Tikkurila, a Nordic paint and coatings company.N/AEstoniaHere
29-DecTGS BalticTGS Baltic successfully represented Pipes Building OU in a dispute against Narva Vesi AS, a company belonging to the Estonian city of Narva.N/AEstoniaHere
29-DecNoveNove advised Elering on its agreement with Siemens Energy for the construction of three synchronous compensators for frequency stability of the electricity systems at the 330 kilovolt substations in the Estonian communities of Viru, Pussi, and Kiisa.EUR83.5millionEstoniaHere
2-JanAllen & Overy; SorainenKocian Solc Balastik; PRK PartnersN/AEstonia; LatviaHere
19-FebCobaltCobalt assisted Viessmann with the restructuring of its refrigeration systems business in Latvia.N/AEstonia; LatviaHere
22-AprCobaltCobalt advised Lauma Fabrics, a textile manufacturer in the Baltics and Europe, on the delivery of COVID-19 personal protective equipment to Estonia and Latvia.N/AEstonia; LatviaHere
1-DecTGS BalticTGS Baltic advised SIA BRC on its reorganization and cross-boarder merger with OU Balti Realiseerimiskeskus and BR Merger OU.N/AEstonia; Latvia
11-DecCobaltCobalt advised US biotech company Biogen on launching its business in Latvia and Estonia.N/AEstonia; LatviaHere
18-FebCobaltCobalt advised SEB life insurance entities in Estonia, Latvia, and Lithuania on a cross-border merger in the Baltics.N/AEstonia; Latvia; LithuaniaHere
11-JunSorainenSorainen successfully defended the interests of racing organizer NASCAR in disputes involving the registration of the company's trademark in Lithuania, Latvia, and Estonia.N/AEstonia; Latvia; LithuaniaHere
3-JulSorainenSorainen advised the Vienna Insurance Group on consolidating the businesses of its group non-life insurance companies Compensa and Seesam in Lithuania, Latvia, and Estonia.N/AEstonia; Latvia; LithuaniaHere
22-JulEllex (Klavins); Ellex (Raidla); Ellex (Valiunas); Latham & Watkins; SorainenSorainen advised the Bite Group on a EUR 700 million bond issuance and refinancing. Latham & Watkins and Ellex reportedly advised initial bond purchasers and mandated lead arrangers Citigroup Global Markets Limited, Deutsche Bank AG, London Branch, ING Bank N.V., London Branch, and UniCredit Bank AG.EUR700millionEstonia; Latvia; LithuaniaHere
9-OctSorainenSorainen advised Infracapital and AMP Capital on the sale of their combined ownership interest in Adven, a provider of clean energy solutions across the Nordics and Baltics, to unnamed institutional investors.N/AEstonia; Latvia; LithuaniaHere
17-NovArendt & MedernachArendt & Medernach helped INVL Asset Management launch the INVL Sustainable Timberland and Farmland Fund II.N/AEstonia; Latvia; LithuaniaHere
30-JulDeloitte Legal; Kaevando & PartneridLawyers from Deloitte Legal's Lithuanian and Estonian offices advised Lonas UAB, a manufacturer of mattresses and beds, on its acquisition of Estonia's Dreamland Home OU, a retailer and wholesaler of bedroom products, from ITIS Holding OU. Kaevando & Partnerid advised the sellers on the deal.N/AEstonia; LithuaniaHere
13-NovNjordNjord advised GVP Invest Estonia OU on its development of a second Hilton hotel in Estonia.EUR100millionEstonia; Lithuania
22-DecBryan Cave Leighton Paisner; TGS BalticTGS Baltic and Bryan Cave Leighton Paisner advised the Mubadala Investment Company on investment in MEL Science - part of the latter's USD 14 million Series B funding round.N/AEstonia; RussiaHere
11-FebZepos & YannopoulosZepos & Yannopoulos advised Greek real estate developer ZOIA on the acquisition of 16 real estate properties in Athens from various unnamed sellers.N/AGreeceHere
20-FebKoutalidisKoutalidis advised Alpha Bank S.A. on matters of Greek Law related to its issuance of a EUR 500 million Tier 2 subordinated bond.EUR500millionGreeceHere
24-MarKaratzas & Partners; White & Case; Zepos & YannopoulosWhite & Case and Zepos & Yannopoulos advised Centerbridge Partners and Elliott Advisors UK Limited on the acquisition of a EUR 900 million portfolio of secured non-performing small business lending and SME loans from the National Bank of Greece. Karatzas & Partners advised the NBG on the deal.EUR900millionGreeceHere
25-MayDrakopoulos; Koutalidis; Your Legal PartnersKoutalidis advised Aktor Concessions S.A. on its successful bid to own, use, administer, operate, and exploit the Marina of Alimos. The concession, which is good for 40 years, was granted by the Hellenic Asset Development Fund. The HADF was advised by Dracopoulos & Vassalakis and Your Legal Partners.EUR177millionGreeceHere
28-MayAlexiou-Kosmopoulos; Dracopoulos & Vassalakis; Your Legal PartnersDracopoulos & Vassalakis, Your Legal Partners, and Alexiou-Kosmopoulos have been appointed as legal advisors to the Hellenic Republic Asset Development Fund on the privatization of regional ports of Alexandroupolis, Heraklion, Igoumenitsa, and Volos through the sale of majority stakes in the state-owned port operating companies.N/AGreeceHere
17-JunKaratzas & Partners; Zepos & YannopoulosZepos & Yannopoulos advised Bain Capital Credit LP on the acquisition of a portfolio of approximately 2,800 primarily secured non-performing corporate loans, originated or otherwise owned by National Bank of Greece S.A. Karatzas & Partners advised the NBGEUR1.6billionGreeceHere
17-JunKaratzas & Partners; Zepos & YannopoulosZepos & Yannopoulos advised arrangers Alantra Corporate Portfolio Advisors, Mediobanca - Banca di Credito Finanziario, and security trustee, cash manager, and account bank Citibank London branch on the EUR 7.5 billion multi-asset NPE securitization of Eurobank Ergasias. Karatzas & Partners advised Eurobank Ergasias.EUR7.5billionGreeceHere
22-JunKaratzas & Partners; Karatzas & Partners; KoutalidisKoutalidis advised Eurobank Ergasias S.A. on the sale of 80% stake of subsidiary Eurobank Financial Planning Services to DoValue S.p.A. DoValue was advised by Karatzas & Partners.EUR11.3billionGreeceHere
15-JulDrakopoulosDrakopoulos advised Brook Lane Special Situations Fund on the reverse (downstream) merger of two of the group's entities.EUR26.5millionGreece
21-JulBahas Gramatidis & PartnersBahas, Gramatidis & Partners is advising Coffee Berry and Hans & Gretal on the creation of their corporate structures and the structuring of franchise agreements for Greece and abroad.N/AGreeceHere
22-JulKoutalidisKoutalidis advised investment fund Southbridge Europe Mezzanine and the founders of Skroutz S.A. on the sale of a minority stake in Skroutz S.A. to CVC Capital Partners.N/AGreeceHere
28-JulKoutalidisKoutalidis advised mandated lead arrangers Bank of Greece, Alpha Bank, Eurobank, Piraeus Bank, and Euroxx Securities, and issuance advisors Eurobank and Piraeus Bank, on Lamda Development S.A.'s issuance of a EUR 320 million bond and it admission to trading on the Athens Exchange.EUR320millionGreeceHere
31-JulNorton Rose FulbrightNorton Rose Fulbright advised Admie, the owner and operator of the Greek electricity transmission grid, on the concession for the Crete-Attica high-voltage direct current interconnection project, which was granted to Admie's subsidiary Ariadne Interconnection.N/AGreeceHere
11-AugZepos & YannopoulosZepos & Yannopoulos advised Pancreta Bank on its transformation from a cooperative bank into a "societe anonyme."N/AGreeceHere
19-OctBernitsas; Hogan Lovells; Kyriakides Georgopoulos; Norton Rose Fulbright; White & Case; Zepos & YannopoulosWhite & Case and Zepos & Yannopoulos advised the EIF and the EBRD on securitization of automotive leases originated by Olympic Commercial and Tourist Enterprises S.A., a car leasing company in Greece that is the master franchisee of the Avis Budget Group. Avis was advised by Norton Rose Fulbright andKyriakides Georgopoulos, while Hogan Lovells and M&P Bernitsas advised lead manager and sole arranger Citi and co-lead manager Piraeus Bank.EUR130millionGreeceHere
4-NovDrakopoulosDrakopoulos represented Evangelos Tsoumpas before the Court of Appeal in a banking and insurance law matter against Ergon Insurance and the Agricultural Bank of Greece.EUR5.3millionGreece
18-NoviLaw; Zepos & YannopoulosZepos & Yannopoulos assisted Globecast France throughout an international open tender procedure for the provision of global signal transmission by the Hellenic Broadcasting OrganizationN/AGreeceHere
26-NovZepos & YannopoulosZepos & Yannopoulos advised the Generali Group on the acquisition of an office building in Athens from Panterra.N/AGreeceHere
1-DecKLCGreece's KLC Law Firm advised National Energy Holdings in its first investment in Greece - the acquisition and construction of five solar parks to be constructed in Central Greece, with a total capacity of 24 MW, for which it secured financing of EUR 22 million from Piraeus Bank.N/AGreeceHere
18-DecDrakopoulos; Grafanaki & Associates; Karatzas & PartnersDrakopoulos advised Brook Lane Special Situations Fund on the acquisition of Sorosos Real Estate, a company owning an office building in a prime location, in parallel with the acquisition from Bain Capital of a bond loan issued by the company. Karatzas & Partners advised Bain Capital. Grafanaki & Associates advised the sellers.EUR11.5millionGreece
22-DecKLCGreece's KLC Law Firm assisted Italy's Edison on the sale of its Edison Exploration & Production subsidiary to Greece's Energean.N/AGreeceHere
24-DecAnagnostopoulosAnagnostopoulos successfully defended former Siemens executive Dionysios Dendrinos in a criminal case regarding alleged bribery and money laundering.N/AGreeceHere
30-DecDrakopoulos; Grafanaki & AssociatesDrakopoulos advised Brook Lane Special Situations Fund on its acquisition of aĂŠ commercial real estate asset that is leased out to Antenna TV and the Regional Administration of Northern Athens. Grafanaki & Associates advised the sellers.EUR5.87millionGreece
30-DecBernitsasBernitsas Law advised CVC on the acquisition of a controlling stake in Vivartia Holdings SA.N/AGreeceHere
30-AprBird & Bird; Kyriakides GeorgopoulosBird & Bird and Kyriakides Georgopoulos advised Bank Gospodarstwa Krajowego on a credit agreement annex.EUR15.5millionGreece; PolandHere
10-NovAllen & Overy; LinklatersAllen & Overy advised Lamda Hellix on its sale to Digital Realty's Interxion subsidiary. Linklaters advised the buyer on the deal.N/AGreece; PolandHere
1-JanFilip & Company; FreshfieldsFilip & Company advised the National Bank of Greece S.A. on the sale of its participation in the share capital of Banca Romaneasca S.A to Eximbank, a state-owned bank in Romania. Freshfields advised on English Law.N/AGreece; Romania
1-JanBarna es Tarsai; SzecskaySzecskay represented Hendrix Genetics BV, a multi-species animal breeding, genetics, and technology company, on the sale of the turkey breeder Greleger Kft. and its four poultry farms to Nagisz Zrt. Barna es Tarsai advised Nagisz.N/AHungary
13-JanDLA Piper; EY LawDLA Piper advised Bernard Matthews/Boparan Group on the sale of Hungarian poultry producer SaGa to the Hungarian Master Goods Group. Vamosi-Nagy Ernst & Young Law Office represented the buyer.N/AHungary
24-JanKatona Gyorgy Law Office; Lakatos, Koves & PartnersLakatos, Koves & Partners advised Soulbrain on the acquisition of a development site from the state-owned National Industrial Park Management and Development Company. The sellers were advised by the Katona Gyorgy Law Office.N/AHungaryHere
28-JanBLS; SchoenherrHungary's BLS Law Firm advised LP Portfolio on its issuance of HUF bonds under the Bond Funding for Growth Scheme announced by the Central Bank of Hungary. Schoenherr advised the arranger, OTP Bank.N/AHungaryHere
28-JanJalsovszkyJalsovszky advised both parties on the sale by Magyar Posta Takarek Ingatlan Befektetesi Alap of the Buda Business Center Office Building to an unnamed real estate fund.N/AHungaryHere
29-JanJalsovszky; LovaszJalsovszky advised Magyar Posta Takarek Ingatlan Befektetesi Alap on its sale of a retail portfolio, consisting of warehouses in the Hungarian communities of Ajka, Albertirsa, Dunaujvarosm, and Oroshaz. The unidentified buyers were advised by Lovasz.N/AHungaryHere
30-JanCMSCMS Hungary advised India-based manufacturing company SRF Limited on an EUR 70 million credit facility.EUR70millionHungaryHere
31-JanHBK Parters; Jalsovszky; NoerrNoerr advised ElringKlinger AG on the sale of the Heliport Industrial Park in Kecskemet, Hungary, to a consortium led by Infogroup and including an equity fund owned by the Municipality of Kecskemet. Jalsovszky advised Infogroup and HBK Partners advised Kecskemet on the deal.N/AHungaryHere
31-JanDLA PiperDLA Piper advised sole shareholder Equilor Alapkezelo Zrt. on the merger of two real estate SPVs, V177 Kft. and Vaci 175 Irodahaz Kft., into one: V Development Kft.N/AHungary
5-FebDLA PiperDLA Piper advised the Hungarian Fund Management Company on the acquisition of Forgacs Intezet, a company focusing on the provision of reproductive health services and obstetric and outpatient care. The unidentified seller was advised by Solo Practitioner Forgacs Vince.N/AHungaryHere
5-FebDLA PiperDLA Piper advised the Hungarian Fund Management Company on its acquisition of shares in Sterilitas and Varandos. Solo practitioner Istvan Devai advised the unidentified seller on the deal.N/AHungaryHere
5-FebGattai Minoli Agostinelli & Partners; SchoenherrSchoenherr advised Sonepar S.A. on its acquisition of Hungarian electricity and telecommunication equipment distributor Marchiol Kft. from Marchiol S.p.a., which was advised by Gattai Minoli Agostinelli & Partners.N/AHungary
6-FebDentons; DLA PiperDLA Piper advised Optima Investment Co Ltd on the sale of the Reno Udvar real estate project in Hungary to the Chi Fu Group. Dentons advised the buyer on the deal.EUR60millionHungaryHere
5-MarNoerr; P+P Pollath & PartnersThe Budapest office of Noerr joined the firm's multi-jurisdictional team advising Saxonia Systems Holding GmbH on its sale of Saxonia Systems AG to Carl Zeiss AG. P+P Pollath & Partners advised the buyers on the deal.N/AHungaryHere
1-AprLakatos, Koves & PartnersLKT advised joint lead managers Citigroup Global Markets Limited, ING Bank N.V., and J.P. Morgan Securities plc on Hungary's EUR 2 billion note issuance, which consisted of (i) EUR 1 billion in aggregate principal amount of 1.125 percent notes due 2026 and (ii) EUR 1 billion in aggregate principal amount of 1.625 percent notes.EUR2billionHungary
3-AprDentons; Jalsovszky; Noerr; Szabo Kelemen & Partners Andersen AttorneysNoerr advised the Doktor24 Group on a series of transactions, including raising private equity capital and acquiring two healthcare companies in Hungary: Svabhegyi Gyermekgyogyintezet and Kastelypark Klinika. Dentons advised the co-investors on the funding, the Jalsovszky Law Firm advised the sellers of Svabhegyi Gyermekgyogyintezet, and Szabo Kelemen & Partners advised the sellers of Kastelypark Klinika.N/AHungaryHere
14-AprJalsovszky; OppenheimJalsovszky advised Szkaliczki Holding on the sale of Szkaliczki & Partners Plastic Processing Ltd to Nefab AB, a Swedish company that offers multi-material packaging solutions and logistics services. Oppenheim advised Nefab.N/AHungaryHere
1-MayClifford Chance; Lakatos, Koves & Partners; Zsolt Szita Law FirmLKT advised the managers in connection with the EUR 1.5 billion 1.75 percent green notes issued by the Government Debt Management Agency Private Company Limited by Shares of Hungary. Clifford Chance London was English law counsel to the joint lead managers and Zsolt Szita Law Firm advised AKK (The Hungarian Asset Management Agency).EUR1.5billionHungary
19-MayAllen & Overy; Gardos Mosonyi TomoriBalazs Sahin-Toth, Counsel in the Budapest office of Allen & Overy, working pro bonoin conjunction with Peter Gardor from Hungary's Gardos Mosonyi Tomori Law Firm and Hungarian solo practitioners Adel Kegye and Eleonora Hernadi, persuaded the Hungarian Supreme Court to uphold a lower court's decision that the Hungarian segregation of Roma students between 2003 and 2017 provided a lower level of education.N/AHungaryHere
28-MayD'Ornano Partners; RSM Legal Szucs & PartnersD'Ornano Partners advised the Hungarian subsidiary of the Ruget group on the transfer of assets and the sale of real estate to Hungary's Ferzol Group. RSM Legal Szucs & Partners advised Ferzol on the deal.N/AHungaryHere
29-MayDLA PiperDLA Piper advised Waterlogic on the acquisition of the water machine portfolio of Vedoital Kft. Solo practitioner Lenard Raffai advised Vedoital.N/AHungary
1-JunDeloitte Legal; Lakatos, Koves & PartnersLKT represented LGI Denmark Aps, a subsidiary of BHJ Group, regarding the acquisition of 75% of the shares of Organo-Pet Kft. a local pet food manufacturer, from Szilagyi Family Holding. Deloitte Legal represented the seller.N/AHungary
1-JunClifford Chance; DLA Piper; Lakatos, Koves & PartnersLKT acted as Hungarian counsel of arrangers Erste Bank, J.P. Morgan, and ING Bank on Magyar Fejlesztesi Bank's EUR 750 million 5-year Eurobond issuance on the main board of the London Stock Exchange. Clifford Chance advised the arrangers on English law and DLA Piper advised the issuer.EUR750millionHungary
24-JunCerha Hempel; Lakatos, Koves & PartnersLakatos Koves & Partners advised the Dubai-based Al Habtoor Group on the sale of Budapest's Rumbach Center to GalCap Europe, a real estate asset and investment manager operating in Austria and Central Europe. Cerha Hempel advised GalCap Europe on the deal.N/AHungaryHere
10-JulCerha HempelCerha Hempel's Budapest office helped set-up a new company - Cetin Hungary - by way of a de-merger from Telenor Hungary.N/AHungaryHere
30-JulDLA Piper; KinstellarKinstellar advised the Hungarian State on a greenfield investment in a helicopter spare parts manufacturing plant to be established in Hungary by Airbus Helicopters and the Hungarian state-owned NLP Nemzeti Legiipari Projekt Kft. DLA Piper advised Airbus Helicopters SAS.N/AHungaryHere
31-JulAllen & Overy; Erdos | KatonaErdos | Katona advised Cordia International Zrt. on its HUF 36 billion bond issuance, made pursuant to the Bond Funding for Growth Program of the Hungarian National Bank. Allen & Overy advised lead arranger Raiffeisen Bank.HUF36billionHungaryHere
31-JulCsetneki Law Firm; NoerrNoerr advised Szallas.hu on the acquisition of Hungarian travel agency group maiUtazas Group. The Csetneki Law Firm advised the sellers.EUR5millionHungary
12-AugErdos | Katona; KinstellarErdos | Katona advised Hell Energy on its refinancing of an existing loan with four unidentified Hungarian banks. Kinstellar reportedly advised the banks.N/AHungaryHere
13-AugCMS; NoerrNoerr's Budapest office advised UniCredit Bank on financing provided to GTC for the development of the Pillar office building in Budapest. CMS reportedly advised GTC on the deal.N/AHungaryHere
19-AugNoerrNoerr's Budapest office advised K&H Bank on financing provided to Wing Zrt. for development of the Gizella Loft office building.N/AHungaryHere
26-AugSzecskaySzecskay advised Dutch company Gilder Investment B.V. on its cross-border merger into a Hungarian member of the group, United Informatics Kft.EUR7.2millionHungary
9-SepKapolyiThe Kapolyi law firm advised Duna House, a property brokerage group in Central and Eastern Europe, on its participation in the National Bank of Hungary's Growth Bond Program.N/AHungaryHere
14-SepCMS; Lakatos, Koves & PartnersLKT advised Vodafone on its negotiations with Futureal regarding the lease of their Budapest headquarters. CMS advised Futureal.N/AHungary
23-SepHogan Lovells; Kinstellar; NoerrNoerr advised UniCredit on financing to South Korean real estate investment trust JR AMC for its acquisition of the Nordic Light Trio office building in Budapest from Skanska. Partos & Noblet - the Budapest office of Hogan Lovells - advised JR AMC on both the financing and the underlying acquisition, while Kinstellar advised Skanska.N/AHungaryHere
23-SepCMS; Garrigues; Linklaters; SzecskaySzecskay and Garrigues advised Spanish renewable energy and gas supplier Audax Renovables SA on its acquisition of Hungarian power retailer Eker from E.ON Hungaria Zrt., the local subsidiary of E.ON SE. CMS and Linklaters advised the seller.N/AHungary
15-OctBird & Bird; DLA PiperDLA Piper advised Granit Bank Zrt and its majority shareholder, EPM Tanacsado Kft, in connection with an investment by way of a capital increase in Granit Bank Zrt by KMVA, a state-owned venture capital fund and a parri passu co-investor, whereby the investors aquired a significant stake in Garnitbank Zrt. Bird & Bird advised KMVA.HUF4.29billionHungary
20-OctDLA PiperDLA Piper advised the shareholders of Csillag Csemege Kft. on the sale of the NAGISZ Group to PortFolion Green Fund.N/AHungary
27-OctDeloitte Legal; Lakatos, Koves & Partners; White & CaseWhite & Case and Lakatos Koves and Partners have advised Mid Europa Partners on the sale of 24% of the issued share capital of Waberer's International Nyrt to Trevelin Holding Zrt, the Hungarian-based member of Indotek Group. Deloitte Legal advised Trevelin Holding on the deal.N/AHungaryHere
30-OctClifford Chance; Lakatos, Koves & Partners; Radvanyi Law FirmLKT and Clifford Chance advised Fitesa Hungary on its acquisition of the Tredegar Corporation's Personal Care Films business. The Radvanyi Law Firm advised the seller.N/AHungary
4-NovHumpfner Law Firm; KinstellarKinstellar advised Resolution Property on its acquisition of an approximately 37,200 square meter office portfolio in Budapest from Hungarian fund manager Adventum Zrt. Adventum was advised by the Humpfner Law FirmN/AHungary
6-NovKertesz and Partners; Lakatos, Koves & PartnersLakatos Koves & Partners advised Innobyte on the sale of a majority stake in the company and its Innoware subsidiary to IT company 4iG. Following the approval of the Hungarian Competition Office, the transaction closed in October. Kertesz and Partners advised 4iG on the deal.N/AHungaryHere
16-NovSchoenherrSchoenherr advised Doosan on its EUR 210 million investment in its copper foil production base in Tatabanya, Hungary, for the construction of another factory on the location.EUR210millionHungaryHere
1-DecAshurst; KinstellarKinstellar advised mandated lead arranger and facility and security agent Bank of China on a USD 75 million financing for the construction of a 100 MWp photovoltaic power plant in Kaposvar, Hungary. Ashurst acted as English counsel to Bank of China on the transaction.USD75millionHungary
9-DecBan, S. Szabo & PartnersBan, S. Szabo & Partners advised Vodafone on the demerger of Vantage Towers in Hungary.N/AHungaryHere
17-DecCerha Hempel; SchoenherrSchoenherr advised Masped Group on the sale of its railway cargo business to the GATX corporation. Cerha Hempel advised the buyer.N/AHungary
22-DecDeloitte Legal; SchoenherrSchoenherr advised Switzerland-based technology company ABB on the sale of its plant in Ozd, Hungary, to wellness equipment producer Wellis, which was advised by Deloitte Legal.N/AHungaryHere
22-DecDLA Piper; HBK Partners; Kinstellar; Nagy es Kiss Law Office; Szabo Kelemen & Partners Andersen AttorneysDLA Piper advised the owners of the Budapest Bank Group, the KB Bank Group, and the Takarekbank Group on their establishment of the Hungarian Bankholding Ltd. financial holding company. Rothschild & Co was the lead transactional advisor on the transaction. Kinstellar and HBK Partners represented MKB Bank, Nagy es Kiss Law Office represented Budapest Bank, and Szabo Kelemen & Partners Andersen Attorneys represented Takarekbank.EUR2billionHungaryHere
29-DecNoerrNoerr advised Chinese lithium batteries precision parts manufacturer Shenzhen Kedali Industry on a EUR 40 million investment in a new battery production plant in Godollo, Hungary.EUR40millionHungaryHere
31-DecSchoenherrSchoenherr helped BOE, a subsidiary of Austria's List Group, conclude a management agreement to manage the Vorosmarty Garage in Budapest.N/AHungaryHere
1-MayNoerrNoerr represented CIG Pannonia in connection with the sale of its non-life insurance portfolio to Aegon.N/AHungary, Poland
3-DecClifford Chance; Germus & Tarsai; SSW Pragmatic Solutions; Wolf TheissSSW Pragmatic Solutions advised the Cotta Group on its acquisition of seven production properties in southwest Poland, and advised Cotta's sister company, Kanizsa Trend, on its acquisition of a production plant in Hungary, from Standard Properties. Germus & Tarsai, Wolf Theiss, and Clifford Chance advised the seller on the deal.N/AHungary; PolandHere
29-DecNoerrNoerr advised Switzerland's Evoco AG on the acquisition of six subsidiaries of Gesco AG from Wuppertal.N/AHungary; RussiaHere
11-DecAllen & Overy; Dentons; Fenwick & West; White & CaseAllen & Overy advised Cisco on the acquisition of Slovakia-based Sli.do technology company from Instando, Anton Zajac, Hewor Property Management, and Kenneth Patrick Ryan. Dentons advised the sellers on the deal with White & Case advising several shareholders. Fenwick & West advised Cisco on US matters.N/AHungary; SlovakiaHere
24-JanDentons; White & CaseDentons advised Enlight Renewable Energy on the construction and EUR 115 million financing of the 105 MW Selac wind farm in Kosovo. The EBRD provided EUR 57 million of the total amount, with Erste Group Bank and NLB Bank providing the remaining EUR 58 million, and with coverage provided by the German export credit agency Euler Hermes. The lenders were advised by White & Case.EUR115millionKosovoHere
1-JanTGS BalticTGS Baltic advised SIA Olaine Logistic Park on its merger with SIA Olaines Logistics.N/ALatvia
15-JanCobalt; SorainenCobalt advised Workday, Inc. on Latvian issues related to its cross-border acquisition of online procurement platform Scout RFP. The sellers were advised by Sorainen.N/ALatviaHere
17-JanCobaltCobalt is representing UAB Niklita in a dispute related to a procurement process organized by the Prisons Administration of the Ministry of Justice of Latvia involving the supply of catering services to prisoners.N/ALatviaHere
6-FebSorainenSorainen advised the Kaamos Group on its acquisition of one-sixth of the shares in Sunly Land.N/ALatviaHere
20-FebDeloitte Legal; Ellex (Klavins); Sorainen; TGS BalticEllex Klavins advised SIA Verus Praedium on its sale of 14.45 hectares of land to SIA Riga Retail Park for the development of a new Saga shopping center. Riga Retail Park was advised by Sorainen.N/ALatviaHere
4-MarEllex (Valiunas); Nestor Nestor Diculescu Kingston Petersen; Penkov Markov & Partners; Uria Menendez; Wardynski & PartnersEllex Valiunas advised Edenred SA on its acquisition of a 60% stake in Lithuania's EBV Finance. The acquisition also included EBV Finance subsidiaries in Bulgaria, Poland, Romania, Spain, and Estonia. Penkov Markov & Partners advised Edenred in Bulgaria, as did Wardynski & Partners in Poland, Nestor Nestor Diculescu Kingston Petersen in Romania, and Uria Menendez in Spain.N/ALatviaHere
5-MarCobaltCobalt successfully represented AS PNB Banka before Latvia's Constitutional Court in a case involving the fee calculation for credit institutions for financing the Financial and Capital Market Commission's operations.N/ALatviaHere
6-MarDeloitte Legal; TGS BalticTGS Baltic and Deloitte Legal advised CVI Dom Maklerski on financing provided to SIA Riga Retail Park for the purposes of co-financing its acquisition of real property as well as the construction and development of the Saga Lifestyle and Shopping Centre in Stopini, a suburb of Riga, by Baltic real estate developer VPH UAB.EUR11millionLatviaHere
12-MarEllex (Klavins); TGS BalticTGS Baltic advised Cooperatieve Rabobank U.A. on its refinancing of Latvian fishing company SIA Batterfisa's existing liabilities and working capital needs. Batterfisa was advised by Ellex Klavins.EUR10millionLatviaHere
9-AprSorainenSorainen advised the Biolars chemical factory on starting the manufacturing of disinfectants in its Latvian production plants.N/ALatviaHere
14-AprAllen & Overy; CobaltCobalt advised joint lead managers Barclays, J.P. Morgan, and Societe Generale on the Republic of Latvia's EUR 550 million Eurobond issuance. Allen & Overy advised the Republic of Latvia on the issuance.EUR550millionLatviaHere
20-AprTGS BalticTGS Baltic advised SIA Saules Aptieka on an agreement with People's Republic of China regarding the supply of surgical face masks to Latvia.N/ALatviaHere
22-AprCobaltCobalt advised APX on an unspecified pre-seed investment into Marine Digital.N/ALatviaHere
23-AprCobaltThe Latvian office of Cobalt, working alongside Clifford Chance, advised Barclays, J.P. Morgan, and Societe Generale on the issuance of a 3-year Eurobond by the Republic of Latvia in an amount of EUR 1 billion. Allen & Overy advised the Republic of Latvia.EUR1billionLatviaHere
24-AprCobaltCobalt advised arranger and sole book-runner AB SEB Bankas on financial institution Altum's issuance of EUR 20 million notes.EUR20millionLatviaHere
30-AprSorainenSorainen advised NEFCO on its investment in the Second Mezzanine Fund, which is managed by FlyCap.N/ALatviaHere
11-MaySorainenSorainen represented YIT Latvija in a dispute over the legality of a construction permit.N/ALatviaHere
15-MayCobaltCobalt assisted with the drafting of the terms and conditions of moratoria introduced by Latvian banks and liaised with the Latvian competition authority to obtain backing for the process and outcome of negotiation.N/ALatviaHere
20-MayKronbergs Cukste Levin; Primus Derling; VilgertsKronbergs Cukste Levin advised environment management group Eco Baltia on the sale of a controlling stake in the company to INVL Baltic Sea Growth Fund. Vilgerts and Primus Derling advised the buyers on the deal.N/ALatviaHere
29-MaySorainenSorainen advised Nasdaq CSD SE on a cross-border merger with Nasdaq CSD Iceland hf.N/ALatviaHere
17-JunTGS BalticTGS Baltic successfully defended the Anti-Doping Bureau of Latvia in the Court of Arbitration for Sport.N/ALatvia
1-JulTGS BalticTGS Baltic represented AS Retail Mezaparks in the purchase of land for the construction of a Rimi supermarket.EUR2millionLatvia
7-JulTGS BalticTGS Baltic successfully represented the Anti-Doping Bureau of Latvia in the Court of Arbitration for Sport.N/ALatviaHere
10-JulCobaltCobalt successfully represented Latvian Television in a copyright and competition dispute against All Media Latvia that reached Latvia's Supreme Court.N/ALatviaHere
14-JulCobaltCobalt provided pro bono advice to the Apeirons Foundation regarding an opinion the latter submitted to the Constitutional Court of Latvia as amicus curiae.N/ALatviaHere
3-AugCobaltThe Latvian office of Cobalt advised AirBaltic on a EUR 250 million investment in its shares by the Latvian Government.EUR250millionLatviaHere
7-AugBDO LawThe Latvian office of BDO Law provided legal analysis to the European Investment Bank regarding a EUR 80 million financing agreement with the Latvian state.EUR80millionLatviaHere
13-AugBDO LawBDO Law advised Deichmann-Schuhe Service-GmbH on its investment of EUR 500,000 in its Latvian subsidiary, SIA Deichmann Apavi, that increased its capital to EUR 1.15 million.EUR500000LatviaHere
20-AugLoyens & Loeff; SorainenSorainen and Loyens & Loeff advised the Kekava ABT consortium on its agreement with Latvian State Roads to construct the Kekava Bypass part of the Via Baltica.EUR100millionLatviaHere
27-AugSorainenSorainen advised the Sarmants event planning association in an intellectual property dispute.N/ALatviaHere
28-AugCobalt; TGS BalticTGS Baltic advised Moller Real Estate Baltic AS on the acquisition of a land plot near the Riga International Airport and an office-warehouse building located on it. Cobalt advised the unidentified sellers on the deal.N/ALatviaHere
31-AugCobaltCobalt successfully represented the Latvian Television TV network before the Administrative District Court and Administrative Regional Court of Latvia against an association of political parties challenging the rules set by the network related to the allocation of airtime leading up to parliamentary elections.N/ALatviaHere
14-SepSorainenSorainen advised Brette Haus on the preparation of a sales contract template for prefabricated folding houses.N/ALatviaHere
18-SepCobalt; OrrickCobalt advised capital300 and Chalfen Ventures on a EUR 5 million series A investment into Riga-based startup Lokalise. Orrick advised the start-up.EUR5millionLatviaHere
22-SepEllex (Klavins)Ellex Klavins helped Gulbenes Autobuss and Balvu Autotransports successfully contest a procurement award involving a regional passenger carriage in Latvia to the country's Procurement Monitoring Bureau.N/ALatviaHere
28-SepActus Q; CobaltCobalt advised Dithmarschen Baltic GmbH on its acquisition of 100% of Dan-Lat Invest and ODK & RB. Actus Q advised the sellers on the deal.N/ALatviaHere
30-SepCobaltCobalt represented Latvia's Central Election Commission in proceedings before the Regional Administrative Court in Riga regarding the annulment of extraordinary elections to the Riga City Council.N/ALatviaHere
13-OctCobaltCobalt advised two natural persons in an administrative appeal of a decision of Latvia's Office of Citizenship and Migration Affairs denying them residence permits due to non-compliance with the provisions of the Immigration Law.N/ALatviaHere
30-OctSorainen; TGS BalticTGS Baltic advised Latvia's SIA Tepix on the sale of its carpet rental business to SIA Lindstrom. Sorainen advised Lindstrom on the deal.N/ALatviaHere
5-NovCobalt; SorainenCobalt advised Latvian IT company Tilde on the sale of its Jumis Pro accounting and business management system business to Nordic IT company Visma. Sorainen advised Visma on the deal.N/ALatviaHere
6-NovSorainenSorainen advised Lords LB Baltic Fund III, managed by the Lithuanian investment company Lords LB Asset Management, on the sale of a logistics center in Riga to EfTEN Real Estate Fund 4.N/ALatviaHere
6-NovSorainenSorainen advised the Vienna Insurance Group on its acquisition of the remaining 9.17% shares in BTA Baltic Insurance Company from AAS Balcia, making VIG the company's sole shareholder.N/ALatviaHere
6-NovGlimstedt; SorainenSorainen Latvia advised Isnaudas Forest Holding on the sale of its five subsidiaries to SCA Mezs Latvija. Glimstedt advised Mezs Latvija on the deal.EUR44.5millionLatviaHere
26-NovCobaltCobalt, acting pro bono, represented the "Association of LGBT and Their Friends Mozaika" as amicus curiae before the Constitutional Court of Latvia regarding the right of same-sex couples to parental leave.N/ALatviaHere
27-NovSorainenSorainen advised the USS Grupp on its acquisition of the Latvian branch of the Securitas security services company.N/ALatviaHere
16-DecCobalt; EcovisCobalt advised the Eurion Fund on the acquisition of an office buildng in Riga from the Baltic RE Group. Ecovis Convents Law Office advised the Baltic RE Group on the deal.N/ALatviaHere
23-DecCobaltCobalt's Riga office successfully represented SIA Latsson Licensing, the owner of online gaming platform Betsafe Latvia, before the Constitutional Court of Latvia regarding the restrictions on its provision of interactive gaming services during a state of emergency.N/ALatviaHere
21-DecTGS BalticTGS Baltic represented SIA GLD Company in a real estate sale transaction in the Marupe district near Riga.N/ALatvia
2-MarSorainenSorainen advised Credit Suisse on matters of Latvian and Lithuanian law related to its EUR 27 million loan to Amber Beverage Group,EUR27millionLatvia; Lithuania
2-AprSorainenSorainen, working alongside Sweden's Mannheimer Swartling, is advising KPMG Sweden on its acquisition of KPMG Latvia and KPMG Lithuania.N/ALatvia; LithuaniaHere
22-AprSorainenSorainen successfully represented Lithuania's E Energija against the Republic of Latvia in an ICSID arbitration.N/ALatvia; LithuaniaHere
9-JunTGS BalticTGS Baltic helped Utenos Trikotazas AB optimize its operations and dispose of certain assets.N/ALatvia; Lithuania
15-AugTGS BalticTGS Baltic assisted Baltic Mill with the drafting of templates for the group's business operations.N/ALatvia; Lithuania
31-AugEllex (Klavins); Ellex (Valiunas); TrinitiEllex advised Quaero European Infrastructure Fund II on the acquisition of Digitalas Ekonomikas Attistibas Centrs from Solo Investments SIA, Astondesmit Astoni SIA, Duo Investicijas SIA, and KFP SIA. Triniti advised the sellers on the transaction.N/ALatvia; LithuaniaHere
8-SepCobalt; GlimstedtGlimstedt advised UAB CGP Management on the sale of four private medical service operators in Lithuania to Latvia's Repharm healthcare group. Cobalt advised Repharm on the deal.N/ALatvia; LithuaniaHere
27-OctCobaltCobalt advised Latvia's Repharm healthcare group on the acquisition of a network of MediCA, Kardiolita, and 33 other clinics from UAB CGP Management, and their subsequent merger with InMedica, a network of medical clinics indirectly managed by the INVL Baltic Sea Growth Fund.N/ALatvia; LithuaniaHere
10-NovTGS BalticTGS Baltic assited Zemaitijos Pienas AB with investments in SIA Muizas Piens.N/ALatvia; Lithuania
2-JanSorainenSorainen advised investment management company Orion Asset Management on the acquisition by its SPV-39 subsidiary of Pletros Investicijos, the company managing the "Palanga Bypass" - a 8.25 part of the road from Klaipeda to Liepaja in Lithuania - via a public-private partnership.N/ALithuaniaHere
2-JanTGS BalticTGS Baltic advised AUGA group, AB on a bond program worth up to EUR 60 million and the issuance of EUR 20 million in green bonds in Lithuania.EUR80millionLithuaniaHere
3-JanFort; TGS BalticFort Legal advised Gateway Airport Services on its acquisition of 100% shares of Litcargus, an aircraft ground handling company in Vilnius. TGS Baltic advised the sellers, Central European Airport Services S.A, a company managed by Royalton Partners.N/ALithuaniaHere
3-JanSorainenSorainen advised InMedica medical clinic network on its issuance of bonds planned for listing on First North, an alternative securities market administered by Nasdaq Vilnius.EUR5millionLithuaniaHere
17-JanSPC LegalSPC Legal successfully represented UAB T Parkas in a dispute regarding the termination of a state-owned land lease agreement with another user of the land plot.N/ALithuaniaHere
17-JanSPC LegalSPC Legal advised UAB Akmenes Projektai, a company managed by Domestique Asset Management, on unspecified investment agreements with Akmene FEZ Management Company in the Akmene free economic zone in Lithuania.N/ALithuaniaHere
17-JanCobalt; WallessWalless advised the Affidea Group on its acquisition of 100% of the shares of UAB Kuncu Ambulatorine Klinika, the operator of the Vetrunge clinic in Klaipeda, Lithuania. Cobalt advised the unidentified seller on the deal.N/ALithuaniaHere
17-JanSorainen; WallessWalless advised Spanish companies Elecnor and Abengoa on their agreement to electrify the Vilnius railway hub and the Kaisiadorys-Klaipeda railway for Lithuania's state-owned railway company Lietuvos Gelezinkeliai. Sorainen advised Lietuvos Gelezinkeliai on the contract.EUR363millionLithuaniaHere
22-JanSorainen; SPC LegalSPC Legal advised real estate investment company Capital City Group on the sale to a company managed by Kenova Asset Management of a tunnel car-wash station in Lithuania that is leased by UAB Svaros Broliai. Sorainen advised the buyers on the deal.N/ALithuaniaHere
24-JanSorainenSorainen advised Rocket Software on opening a new development center in Vilnius.N/ALithuaniaHere
27-JanDeloitte LegalThe Lithuanian office of Deloitte Legal advised Aurora Cannabis Inc. on the merger of its two Lithuanian subsidiaries, Agropro and Borela.N/ALithuaniaHere
28-JanSorainenSorainen advised venture capital fund Startup Wise Guys on its investment in Lithuanian transport management system developer GoRamp.N/ALithuaniaHere
31-JanDLK LegalDLK Legal helped Digital Virgo obtain an e-money institution license for Lithuania's Digital Virgo Payment UAB.N/ALithuaniaHere
4-FebDerling PrimusDerling Primus helped NBC Security, Inc. establish UAB Baltic Defense Industries, which will manufacture military and defense products in Lithuania for global defense and law enforcement agencies.N/ALithuaniaHere
4-FebCobaltCobalt advised Iron Wolf Capital on its EUR 1.6 million investment in Integrated Fiber Optics.EUR1.6millionLithuaniaHere
6-FebEllex (Valiunas); Motieka & AudzeviciusMotieka & Audzevicius advised MyFitness, a sports and fitness club operator, on the acquisition of Lithuania-based Gym Plius. Ellex Valiunas advised the unidentified sellers on the deal.N/ALithuaniaHere
7-FebBBA Fjeldco; Motieka & AudzeviciusMotieka & Audzevicius advised Avia Solutions Group on the acquisition of Bluebird Nordic, a cargo airline headquartered in Iceland. Bluebird Nordic was reportedly advised by Iceland's BBA//Fjeldco law firm.N/ALithuaniaHere
7-FebEllex (Valiunas); TendenEllex Valiunas and Norway's Tenden law firm advised Norway's Passer Group on its acquisition of 49% of shares in Lithuania's SIDC Group.N/ALithuaniaHere
12-FebAshurst; SorainenSorainen won a tender to advise Lithuania's state-owned Ignitis Group on an initial public offering it is currently considering. Ashurst will be advising on English and US law aspects.N/ALithuaniaHere
19-FebCobaltCobalt advised Genopas B.V. and Nunica Holdings B.V. on the sale of their 100% shareholding in UAB Pusbroliai to Idex Baltic.N/ALithuaniaHere
20-FebSorainenSorainen advised Baltic Mill on its third bond issuance and the bonds' listing on Nasdaq Baltic First North, an alternative bond market managed by Nasdaq Vilnius. Sorainen also advised arranger Siauliu Bankas on the deal.EUR3millionLithuaniaHere
25-FebAdon LegalAdon Legal helped Seili UAB set-up its operations as a consumer credit provider and mortgage credit provider.N/ALithuaniaHere
28-FebEllex (Valiunas)Ellex Valiunas helped Lords LB Baltic Fund IV negotiate a lease agreement for a building in Vilnius with Northern Lyceum.N/ALithuaniaHere
4-MarWallessWalless advised Tadas Bulotas on the sale of Lithuania's BBaltics sports agency to the Wasserman sports agency.N/ALithuaniaHere
4-MarCobalt; Ellex (Valiunas)Ellex Valiunas advised Fan19 on its acquisition of Engagecraft. Cobalt advised the unidentified seller on the deal.N/ALithuaniaHere
5-MarSorainenSorainen advised Autoukis NT on the sale of a complex of buildings in Vilnius to a company controlled by the Hanner Group.N/ALithuaniaHere
5-MarPohla & HallmagiPohla & Hallmagi advised Norway's Selvaag Eastern European Development Fund OU on the sale of its LIthuanian subsidiary, UAB Parkavimo Paslaugos, to UAB Baltexpro.N/ALithuaniaHere
11-MarSorainenSorainen successfully defended HR solutions provider Amston before Lithuania's Equal Opportunities Ombudsperson.N/ALithuaniaHere
11-MarSPC LegalSPC Legal successfully represented the non-profit Baltic Environmental Forum in Vilnius' Administrative Court in its claim that the State Service for Protected Areas unlawfully suspended the expansion of Lithuania's Punia pinewood reserve.N/ALithuaniaHere
16-MarTGS BalticTGS Baltic successfully represented Orlen Lietuva before the Court of Appeal of Lithuania in a dispute regarding Polocktransneft Druzhba's claim for damages of over USD 70 million.USD70millionLithuaniaHere
24-MarMotieka & AudzeviciusMotieka & Audzevicius helped Nandi Finance obtain an electronic money institution license from the Bank of Lithuania.N/ALithuaniaHere
26-MarSorainenSorainen helped E4F Money obtain an electronic money institution license in Lithuania.N/ALithuaniaHere
30-MarSorainenSorainen advised the Ignitis Group on the receipt of a loan by Pomerania Wind Farm, a Polish company belonging to the group, of a loan from EIB.PLN258millionLithuaniaHere
1-AprTGS BalticTGS Baltic successfully defended Klaipedos Naft before the Court of Appeal of Lithuania in a case involving EUR 6 million in damages.EUR6millionLithuaniaHere
3-AprEllex (Valiunas)Ellex Valiunas successfully defended the interests of the Kaunas City Municipality in a dispute involving the termination of a contract for the reconstruction of S. Darius and S. Girenas Stadium under public procurement rules.N/ALithuaniaHere
6-AprTGS BalticTGS Baltic advised Viada LT on its issuance of EUR 1 million worth of bonds, which will be included to trading on Lithuania's alternative First North stock exchange.EUR1millionLithuaniaHere
7-AprMotieka & AudzeviciusMotieka & Audzevicius is representing big data company Oxylabs in an IP rights infringement dispute in Lithuania.N/ALithuaniaHere
16-AprMotieka & AudzeviciusMotieka & Audzevicius successfully represented AVAgro LLC in a dispute with Singapore-based Dreymoor regarding interim measures pertaining to assets of AVAgro's subsidiary, AVAgro UAB.N/ALithuaniaHere
16-AprMotieka & AudzeviciusMotieka & Audzevicius successfully represented Axis Industries in an insurance indemnification dispute.N/ALithuaniaHere
20-AprSorainenSorainen advised Lords LB Special Fund I Subfund B investment fund on its lease of a 7000 square meter area in its Lvovo business center in Vilnius to Telia Global Services Lithuania.N/ALithuaniaHere
23-AprNoveNove advocates Veikko Puolakainen and Veiko Vaske successfully represented the Political Parties' Supervision Commission in Lithuania's Supreme Court.N/ALithuaniaHere
23-AprSorainenSorainen successfully represented Alfa Bank as the creditor of Arvi Ir Ko in a case concerning the annulment of Arvi Ir Ko sales transactions.N/ALithuaniaHere
23-AprSorainenSorainen provided pro bono advice to Invega on Covid-19 measures for affected businesses.N/ALithuaniaHere
30-AprMotieka & Audzevicius; TGS BalticMotieka & Audzevicius advised the founders of Lithuania's In Balance Grid on the investment of EUR 950,000 into the company by Koinvesticinis Fondas, Contrarian Ventures, and several angel investors, all of which were advised by TGS Baltic.EUR950000LithuaniaHere
4-MayTrinitiTriniti advised the Groa Real Estate Fund I, a fund managed by Groa Capital, on the acquisition of the Rimi Hypermarket shopping center in Vilnius from UAB Sun Invest.N/ALithuaniaHere
6-MayDentons; Sorainen; TGS BalticSorainen advised joint lead managers BNP Paribas, Citi, and Erste Group on a dual-tranche Eurobond issue by the Republic of Lithuania - a 5-year Eurobond of EUR 750 million face value and a 10-year Eurobond of EUR 1 billion 250 million face value.EUR2billionLithuaniaHere
6-MaySorainen; TrinitiTriniti helped Eddy Travels, a Lithuanian startup developing an artificial-intelligence-based digital travel planning assistant, to raise an additional EUR 600,000 to complete an approximately EUR 1.1 million early-stage funding round. Lead investor KUB Open Circle Capital was advised by Dentons.EUR600000LithuaniaHere
11-MayTGS BalticTGS Baltic advised Siauliu Bankas on the issuance of EUR 20 million subordinated bonds and their listing on Nasdaq Vilnius's Debt Securities List.EUR20millionLithuaniaHere
12-MaySorainen; TGS BalticSorainen advised Nitin Shelke, the founder and chairman of Growmore Group, on its acquisition of Medicinos Bankas, a retail bank in Lithuania with USD 395 million in assets, from Konstantinas Karosas and Western Petroleum Limited. The sellers were advised by TGS Baltic.USD395millionLithuaniaHere
15-MaySorainenSorainen advised Orkela on the conversion of the former Sv. Jokubo hospital in the Vilnius city center into a hotel.N/ALithuaniaHere
26-MayEllex (Valiunas); Euroteises BiurasEllex Valiunas advised Northern Ireland's Mzuri Holdings on the acquisition of 60% stake in Lithuanian window covering manufacturer Domus Lumina. Euroteises Biuras advised Domus Lumina.N/ALithuaniaHere
27-MayTGS BalticTGS Baltic successfully defended the interests of TV Play at the Supreme Administrative Court of Lithuania against the Radio and Television Commission of Lithuania in a dispute involving the "must carry" obligation under Lithuanian law.N/ALithuaniaHere
27-MayMotieka & AudzeviciusMotieka & Audzevicius successfully represented the Republic of Serbia before the Lithuanian Court of Appeals in a case regarding the enforcement of Serbia's EUR 12 million claim against am unspecified Lithuanian company.EUR12millionLithuaniaHere
28-MayCobalt; SorainenCobalt advised Lithuania's AB Lietuvos Radijo ir Televizijos Centras on the sale of its data transmission and digital television business developed under the Mezon brand to Lithuania's Bite Group. Sorainen advised Bite on the deal.N/ALithuaniaHere
29-MayClifford Chance; Dentons; TGS Baltic; WallessTGS Baltic and Dentons advised the Ignitis group on its renewed EUR 1.5 billion medium-term debt securities program and EUR 300 million bond issuance. Clifford Chance and Walles advised intermediaries BNP Paribas, Citi, J.P. Morgan, and Luminor bank.EUR300millionLithuaniaHere
1-JunSorainen; TGS BalticSorainen advised Danielius Merkinas and Ceslovas Kazlauskas, the founders of NNL LT, on the acquisition of a 44% stake in NNL LT from Litcapital through an acquisition vehicle. TGS Baltic advised Litcapital.N/ALithuaniaHere
8-JunSorainen; SPC LegalSorainen advised venture capital fund Open Circle Capital on an unspecified investment in Lithuanian marketing startup Billo. SPC Legal advised Billo.N/ALithuaniaHere
10-JunCobaltCobalt advised APX on an unspecified pre-seed investment in Haslle.N/ALithuaniaHere
15-JunCerniauskas & Partners; Glimstedt; TGS BalticTGS Baltic advised venture capital fund Koinvesticinis Fondas and four other business angels on their investment of EUR 210,000 in Lithuanian start-up Funkciniai Gerimai. Cerniauskas & Partners advised Funkciniai Gerimai on the deal, while Glimstedt advised the business angels.EUR210000LithuaniaHere
15-JunEllex (Valiunas); TGS BalticEllex Valiunas advised Quaero European Infrastructure Fund II on the acquisition of UAB Duomenu Logistikos Centras from energy company Ignitis Group and Litgrid. TGS Baltic advised the sellers on the transaction.EUR10.1millionLithuaniaHere
16-JunEllex (Valiunas)Ellex Valiunas persuaded the Supreme Court of Lithuania to rule that the Kaunas City Municipality may continue centralizing food purchases for pre-school education institutions.EUR900000LithuaniaHere
17-JunWallessWalless helped the Ambr Group's set up a Lithuanian subsidiary - Ambr Payments UAB - and obtain an electronic money license from the Bank of Lithuania to issue electronic money and provide payment services.N/ALithuaniaHere
23-JunCobalt; SorainenCobalt advised Western Union Processing Lithuania on its lease of more than 15,000 square meters of office space from Finland's Technopolis real estate investment and management company, which was advised by Sorainen.N/ALithuaniaHere
23-JunSorainen; WallessSorainen advised electronic money institution Verse Payments Lithuania on its acquisition by Square, an electronic payment and financial services company headquartered in San Francisco and listed on the New York Stock Exchange. Walless advised Square.N/ALithuaniaHere
26-JunSorainenSorainen assisted the Kino Pavasaris Vilnius International Film Festival on the removal of counterfeit copies of the Oscar-winning movie "Parasite" from illegal torrent sites in Lithuania.N/ALithuaniaHere
2-JulSorainenSorainen advised Koinvesticinis Fondas on the investment, made along with three business angels, of EUR 100,000 in Lithuanian startup Cogastro, which developed the world's first computer program for insect farm monitoring and management.EUR100000LithuaniaHere
3-JulSorainen; WallessSorainen advised the Darnu Group on the sale of the 15,000 square meter East Hill building in Vilnius's Park Town business center to an investment company jointly owned by the Zenith Family Office and the Dao Family Office. Walless advised the buyers on the transaction.N/ALithuaniaHere
14-JulSorainenSorainen advised Koinvesticinis Fondas on its investment in Nanoenergija, a Lithuanian startup that developed vibration energy harvesting technology to power wireless IoT sensors.N/ALithuaniaHere
21-JulTGS BalticTGS Baltic successfully represented Valstybiniu Misku Uredija -Lithuania's state-owned enterprise responsible for the supervision, administration, and inventory of state forests - before the Supreme Court of Lithuania.N/ALithuaniaHere
22-JulSPC LegalSPC Legal advised UAB Leteja on the sale of Hotel Conti, located in Vilnius' Old Town, to UAB NS Consulting.N/ALithuaniaHere
22-JulTGS BalticTGS Baltic advised the Opera Limited browser provider on its acquisition of Fjord Bank.N/ALithuaniaHere
24-JulCobaltCobalt helped Lithuania's UAB Kedainiai Free Economic Zone draft establishment and operation agreements for Kormotech.N/ALithuaniaHere
28-JulCobaltCobalt advised the EBRD, Swedbank, and Citadele Bank on their provision of a EUR 86 million syndicated loan to UAB Vakaru Medienos Grupe in Lithuania.EUR86millionLithuaniaHere
30-JulSorainenSorainen successfully defended the interests of the Union of Lithuanian Journalists and other journalists in a case investigated by Lithuania's Supreme Administrative Court regarding defense of that country's constitutional right to receive, collect, and share information.N/ALithuaniaHere
4-AugSorainenSorainen advised Alfa Bank on debt recovery efforts against Lithuanian businessman Vidmantas Kucinskas, as well as identifying possibly illegal acts by Kucinskas, who is suspected of financial fraud.N/ALithuaniaHere
5-AugDentons; Sorainen; TGS BalticThe Vilnius office of Sorainen advised dealers BNP Paribas, Citi, and Erste Group on Lithuania's raising of EUR 1.75 billion by means of a 30-year Eurobond issue.EUR1.75billionLithuaniaHere
7-AugIustum; SorainenSorainen advised the Darnu Group on a construction agreement with UAB Naresta for the sixth stage of the Paupys district of Vilnius, in Lituania. UAB Naresta was reportedly advised by the Iustum law firm.N/ALithuaniaHere
11-AugSorainenThe Lithuanian office of Sorainen advised Koinveticinis Fondas on its investment in Ligence, a Lithuanian startup developing an automated cardiac ultrasound diagnostic solution based on artificial intelligence.EUR360000LithuaniaHere
17-AugMotieka & AudzeviciusMotieka & Audzevicius helped CommonSign obtain a payment institution license for account information services.N/ALithuaniaHere
19-AugCobalt; FortCobalt advised UAB Sonex Consulting on the sale of a 6,948 square meter business center in Vilnius to EfTen Real Estate Fund III, which is managed by EfTEN Capital. Fort Legal advised EfTen on the deal.N/ALithuaniaHere
24-AugAndersen Partners; Deloitte LegalDeloitte Legal and Denmark's Andersen Partners advised Maskinhandler Indkobsringen A/S, a Danish farm equipment company, on the sale of a majority stake of shares in MI Agrotinklas UAB to one of MI Agrotinklas's founders.N/ALithuaniaHere
25-AugSorainenSorainen advised Inion LT on a EUR 500,000 investment in the company by venture capital funds Koinvesticinis Fondas and Contrarian Ventures and startup accelerator 70 Ventures.EUR500000LithuaniaHere
27-AugEllex (Valiunas); GlimstedtGlimstedt advised GE Energy Financial Services on an unspecified investment in E Energija's 68.9MW wind farm in Telsiai, Lithuania, which uses GE's Cypress 5.3MW turbines. E Energija was advised by Ellex Valiunas.N/ALithuaniaHere
31-AugEllex (Klavins); Ellex (Valiunas)Ellex Valiunas and Ellex Klavins advised infrastructure investment fund QEIF II on the acquisition of 100% of the shares of Citatalas Economic Development Center.N/ALithuaniaHere
31-AugMotieka & AudzeviciusMotieka & Audzevicius helped Donatas Aleksandravicius, the owner of the Ds Byggeri construction company, file an indemnification claim against Denmark at the ICSID.N/ALithuaniaHere
2-SepWallessWalless advised E Energija on a green energy purchase deal with Eesti Energia.N/ALithuaniaHere
2-SepMotieka & Audzevicius; SorainenSorainen and Motieka & Audzevicius advised Startup Wise Guys and the Motieka Investment Fund on a EUR 1.2 million investment in Lithuanian edu-tech start-up Turing College. Motieka & Audzevicius also advised Turing College on the deal.EUR1.2millionLithuaniaHere
3-SepWallessWalless helped Railsbank Group subsidiary UAB Payrnet obtain an electronic money institution license from the Bank of Lithuania.N/ALithuaniaHere
8-SepAccura; Cobalt; Gessel; Horten; Norton Rose FulbrightThe Lithuanian office of Cobalt and Denmark's Accura law firm advised INVL Baltic Sea Growth Fund on its acquisition of a 48% stake in MBL from Accession Mezzanine Capital III and the Lauritsen family. The Horten, Gessel, and Norton Rose Fulbright law firms reportedly advised the sellers.N/ALithuaniaHere
10-SepWatson Farley & WilliamsWatson Farley & Williams advised the Froelich family on their sale of Froelich Internationale Transporte GmbH & Co. KG to Lithuania's Transimeksa Group.N/ALithuaniaHere
28-SepAshurst; Debevoise & Plimpton; Dentons; Linklaters; Sorainen; TGS Baltic; WallessSorainen, Linklaters, and Ashurst advised Lithuania's state-owned Ignitis Group on its initial public offering and admission to the Vilnius and London stock exchanges. Walless and Dentons advised bookrunners Bank of America, JP Morgan, Morgan Stanley, Swedbank, and UBS on the offering. TGS Baltic and Debevoise & Plimpton advised GDR depositary Bank of New York Mellon.EUR450millionLithuaniaHere
30-SepSorainenSorainen is representing 15min, a news website in Lithuania, in an appeal against a warning issued by Lithuania's State Consumer Rights Protection Authority commission.N/ALithuaniaHere
2-OctTGS BalticTGS Baltic established a pro bono partnership with the Kazickas Family Foundation, an international non-profit organization that supports education, social welfare, technology, culture, and medicine projects in the United States of America, Lithuania, and Africa.N/ALithuaniaHere
5-OctDLA PiperDLA Piper advised Lithuania's Ignitis Group on its acquisition of a 5% stake in the Moray West wind farm project on the east coast of Great Britain currently under development by Ocean Winds, which was established earlier this year as a joint venture by French energy giants Engie and EDPR.N/ALithuaniaHere
6-OctWallessWalless advised Eastnine on the acquisition of an office property in central Vilnius.EUR20millionLithuaniaHere
8-OctSorainenSorainen helped establish the Aid Fund for Business, which will invest public and private funds in enterprises affected by Covid-19.N/ALithuaniaHere
12-OctTriniti (Triniti Jurex)Triniti Jurex successfully represented Restaurants Group Fortas in a dispute with an unnamed insurance company.N/ALithuaniaHere
14-OctGlimstedtGlimstedt successfully represented Nigeria's Arik Air Limited in a cross-border debt collection enforcement case in the Kaunas Regional Court.EUR2millionLithuaniaHere
16-OctTriniti (Triniti Jurex)Triniti Jurex successfully defended the Lithuanian Radio and Television Center Telecentras and its CEO, Remigijus Seris, against a defamation lawsuit filed by the former President of the Lithuanian Business Confederation, Valdas Sutkus.N/ALithuaniaHere
16-OctTriniti (Triniti Jurex)Triniti Jurex successfully represented the Visoriu Slenio Gyventoju Bendruomene association in its petition to the Supreme Administrative Court of Lithuania to order a reevaluation of the environmental impact study regarding planned construction of the M. Lietuvio Street bypass in Vilnius.N/ALithuaniaHere
16-OctSorainenSorainen's Lithuanian office helped Dexcom establish a global business service center in Vilnius, Lithuania.N/ALithuaniaHere
19-OctMotieka & Audzevicius; SorainenSorainen represented Seven Entertainment and its shareholders in the sale of Lithuania's Siemens and Cido multi-purpose arenas, the Tiketa ticket distribution company, and the Seven Live event organization company, to Lithuania's DG21. Motieka & Audzevicius advised the buyer on the deal.N/ALithuaniaHere
21-OctCobalt; WintCobalt advised Arunas Kuraitis on a lease of a building in Vilnius's Old Town from Lithuania's Jesuit Province. Wint advised the Jesuit Province on the deal.N/ALithuaniaHere
21-OctCobaltCobalt advised Practica Capital on the final close of the Practica Venture Capital II fund, which included a EUR 2 million investment from Swedbank Asset Management. The total fundraising amount reached EUR 28.5 million.EUR2millionLithuaniaHere
28-OctTriniti (Triniti Jurex)Triniti Jurex helped Termolink obtain damages from a general contractor for work the company performed on an unspecified project.N/ALithuaniaHere
2-NovMargerMarger Law Firm successfully represented Lithuania's Svencionys municipality in a dispute with an unspecified contractor about the effectiveness of a previous arbitration award that was heard by the Supreme Court of Lithuania.N/ALithuaniaHere
2-NovEllex (Valiunas)Ellex Valiunas helped Curve obtain an electronic money institution license from the Bank of Lithuania and transfer its European activities to the country.N/ALithuaniaHere
4-NovCobalt; FortFort Legal advised Broadcast Solutions on its acquisition of Lithuania's TVC Solutions from Practica Capital and four other unidentified shareholders. Cobalt advised the sellers.N/ALithuaniaHere
11-NovMotieka & AudzeviciusMotieka & Audzevicius successfully represented road construction company Panevezio keliai in several cases against the Vilnius municipality administration related to infringements in the EUR 40 million tender procedures for reconstruction of one of the major intersections in Vilnius.EUR40millionLithuania
17-NovKromann Reumert; WallessWalless advised Sapiens International Corporation on its acquisition of Tia Technologies from EQT Mid Market. Kromann Reumert advised the seller on the deal.N/ALithuaniaHere
18-NovSorainenSorainen advised Bittiq, a Netherlands-based account information manager, on the launch of its business in Lithuania.N/ALithuaniaHere
18-NoviLaw; SPC LegalSPC Legal advised the Panevezys free economic zone of Lithuania on an investment from cable harness manufacturer AQ Wiring Systems. iLaw advised AQ Wiring Systems on the deal.N/ALithuaniaHere
18-NovPrimus; TGS BalticTGS Baltic advised the shareholders of the Baltic hotel services portal NoriuNoriuNoriu on the sale of 90% of the shares of UAB NoriuNoriuNoriu to UAB Disrupta.N/ALithuaniaHere
23-NovFortFort advised the EIKA real estate development company on a five million bond issue, distributed by Siauliu Bankas.EUR5millionLithuaniaHere
27-NovEversheds Sutherland; Squire Patton Boggs; WallessSquire Patton Boggs and Eversheds Sutherland advised the Miss Group on its acquisition of Interneto Vizija from its founders. Walless advised the sellers on the deal.N/ALithuaniaHere
27-NovWallessWalless advised DiPocket on setting up a subsidiary in Lithuania and obtaining an electronic money institution license from the Bank of Lithuania.N/ALithuaniaHere
27-NovEllex (Valiunas)Ellex Valiunas advised Norway's Baltic Sea Properties real estate management company on its sale of 13 buildings to Rivona, a subsidiary of the Norfa Group.N/ALithuaniaHere
27-NovSorainenSorainen advised the Modus Group on its launch of a second public bond issuance, expected to attract investment of EUR 8 million. The bonds are being distributed by Saiuliu Bankas and will be traded on First North, an alternative market administrated by Nasdaq.N/ALithuaniaHere
27-NovTGS BalticTGS Baltic successfully represented Lithuanian Airports in a dispute with the Active Construction Management over major repairs carried out in Vilnius Airport.N/ALithuaniaHere
27-NovTGS BalticTGS Baltic advised the Maxima Group on the merger of its Maxima LT and (Netherlands-based) Lincoln Land Erste subsidiaries.N/ALithuaniaHere
27-NovMotieka & AudzeviciusMotieka & Audzevicius successfully represented the Panevezio Keliai road construction company in a dispute against the City of Vilnius administration.EUR500000LithuaniaHere
27-NovSorainenSorainen advised Startup Wise Guys on its investment in logistics startup GoRamp. Startup Wise Guys, together with Presto Ventures, invested EUR 450,000.EUR450000LithuaniaHere
1-DecTriniti (Triniti Jurex)Triniti Jurex defended the interests of AB Lietuvos Radijo Ir Televizijos Centras in a dispute with the Darnu Group over an EUR 6 million sale of real estate.EUR6millionLithuaniaHere
3-DecWallessWalless advised Norway's BCP Logistic Property III on its sale of the Lithuania's Vinges Terminalas logistics center.EUR10millionLithuaniaHere
3-DecCobalt; SorainenSorainen advised the INVL Sustainable Timberland and Farmland Fund II on its EUR 13.6 million acquisition of seven companies from the Linas Agro Group, advised by Cobalt.EUR13.6millionLithuaniaHere
4-DecWallessWalless helped Crius LT obtain a specialized banking license from the European Central Bank, following the Bank of Lithuania's assessment and proposal.N/ALithuaniaHere
4-DecWallessWalless advised Capitalica Baltic Real Estate Fund I on the issuance of EUR 3 million bonds and their listing on the First North market of Nasdaq Vilnius.EUR3millionLithuaniaHere
15-DecCobaltThe Vilnius District Prosecutor's Office terminated a pre-trial investigation against the former Speaker of the Lithuanian Parliament, Arunas Valinskas, involving charges of incitement of hatred. Cobalt represented Valinskas in the process.N/ALithuaniaHere
15-DecFort; SorainenSorainen's Lithuanian office advised the SBA Group on its EUR 28.6 million sale of a logistics center and a furniture component factory to Estonia's EfTEN Real Estate Fund 4. Fort advised the buyer on the deal.EUR28.6millionLithuaniaHere
15-DecSorainenSorainen advised Emotika on attracting a EUR 100,000 investment from an unspecified US-based investor.EUR100000LithuaniaHere
21-DecMotieka & AudzeviciusMotieka & Audzevicius created an Anti-Money Laundering and Counter-Terrorist Financing program for Newsec Advisers LT.N/ALithuaniaHere
21-DecCobalt; WintCobalt advised Practica Capital on the EUR 1 million investment it made along with a group of other, unidentified, private investors in the RRR.lt online platform, which facilitates the sale of used car parts. Wint advised the owner of the platform on the deal.EUR1millionLithuaniaHere
22-DecSorainenSorainen advised TC Investicija on the sale of a building in Kaunas, Lithuania, to Integrated Stars. Financing for the transaction was provided by Citadele Bank.N/ALithuaniaHere
23-DecDLK LegalDLK Legal helped Finnovative Solutions UAB obtain a payment institution license from the Bank of Lithuania to provide Account Information Services and Payment Initiation Services.N/ALithuaniaHere
24-DecSorainen; WintSorainen advised Decathlon on its agreement with the Galio Group to have the latter build and lease new stores for it in the Lithuanian cities of Kaunas and Klaipeda. Wint advised the Galio Group on the transaction in Klaipeda.EUR8millionLithuaniaHere
28-DecSorainenSorainen advised Luxembourg's REInvest Asset Management and its DEREIF SICAV FIS fund on their acquisition of the building housing SEB Bank's headquarters in Vilnius from the Lords LB Special Fund II.N/ALithuaniaHere
29-DecWallessWalless helped Stanhope Financial establish a subsidiary in Lithuania and obtain an e-money institution license from the Bank of Lithuania.N/ALithuaniaHere
29-DecCobalt; Goodwin; Motieka & Audzevicius; Taylor WessingMotieka & Audzevicius together with Taylor Wessing advised the founders of Eneba Holdings Limited and Helis play on raising series A investment round by well-known venture capital investors. The series A round was led by UK-based InReach Ventures, Lithuanian-based Practica Capital and New York-based investor FJ Labs, alongside several angel investors. Goodwin advised the investors and Cobalt advised Practica Capital.USD8millionLithuaniaHere
30-DecSorainen; TGS BalticSorainen helped renewable energy company Enerstena obtain a EUR 7 million loan from Lithuania's State Aid Fund for Business. TGS Baltic advised the fund on the deal.EUR7millionLithuaniaHere
17-JanDeloitte Legal; Kopec & ZaborowskiThe Lithuanian office of Deloitte Legal participated in a multi-jurisdictional team advising Enva, a provider of recycling and specialist resource recovery solutions in the UK and Ireland, on its acquisition of SAR Recycling Ltd, which was advised by, among others, Warsaw's Kopec & Zaborowski law firm.N/ALithuania; PolandHere
5-MarGladei & Partners; SchoenherrSchoenherr advised Fintur Holdings B.V. on its sale o Moldcell S.A., to CG Cell Technologies DAC. Gladei & Partners advised CG Technologies.USD31.5millionMoldovaHere
1-JulGladei & Partners; Norton Rose FulbrightGladei & Partners and Norton Rose Fulbright assisted EBRD in the roll-over of its new TFP facility through Moldova-Agroindbank and Victoriabank.EUR13millionMoldova
31-AugGladei & Partners; K&L Gates; Tuca Zbarcea & Asociatii; Turcan CazacGladei & Partners and K&L Gates advised the EBRD on the acquisition of a 25% stake in Vestmoldtransgaz, a gas transmission company operating the newly built Ungheni-Chisinau gas pipeline. Turcan Cazac advised Vestmoldtransgaz on the deal, while Tuca Zbarcea & Asociatii advised sellers TransGaz and its Moldovan subsidiary Eurotransgaz.EUR20millionMoldovaHere
26-OctCobzac & PartnersCobzac & Partners advised Mintos Finance Estonia on amending the pledge agreement between Mintos and Sebo Credit that allowed Sebo Credit to pledge part of its assets to another creditor to guarantee a new loan while Mintos Finance Estonia retains a first rank pledge of Sebo Credit's assets.EUR30millionMoldova
17-DecCMS; Gladei & Partners; Schoenherr; Turcan CazacGladei & Partners and Schoenherr assisted Vetropack AG with the acquisition of the Moldovan Glass Container Group companies. Turcan Cazac and CMS advised the sellers.N/AMoldova
21-JanFilip & Company; Freshfields; Osborne Clarke; Turcan Cazac; Vernon David & AssociatesFilip & Company, Freshfields Bruckhaus Deringer, and Vernon David & Associates advised Banca Transilvania on the acquisition of Microinvest. Osborne Clarke and Turcan Cazac advised the sellers on the transaction.N/AMoldova; RomaniaHere
13-AugHillmont PartnersHillmont Partners obtained an award for interim measures for client Komaksavia Airport Invest Ltd in arbitration against the Republic of Moldova related to the concession agreement for the Chisinau International Airport.N/AMoldova; UkraineHere
2-NovHarrisonsHarrisons advised Aer Rianta International on its five-year duty-free concession to run retail stores at the Tivat and Podgorica airports in Montenegro.N/AMontenegroHere
1-FebHarrisonsHarrisons advised the EBRD on Montenegrin aspects of a loan to NLB Bank Podgorica under the EBRD's Women in Business Programme.EUR2millionMontenegro
1-FebHarrisonsHarrisons was engaged by Montenegro's electric power transmission system operator CGES to provide capacity and enforce a legal opinion in relation to a loan that CGES will received from KfW.EUR20millionMontenegro
1-MayClifford Chance; HarrisonsHarrisons, working alongside global advisor Clifford Chance, assisted Credit Suisse with a EUR 250 million facility agreement by and between Republic of Montenegro as the borrower, the International Bank for Reconstruction and Development as the guarantor, and Credit Suisse AG, London Branch, Crnogorska Komercijalna Banka AD Podgorica, and Societe Generale as the lenders.EUR250millionMontenegro
1-JunBird & Bird; HarrisonsHarrisons acted as Montenegrin legal counsel to the EBRD in relation to an unsecured loan to Elektroprivreda Crne Gore AD Niksic. Bird & Bird acted as English law counsel to the EBRD.EUR50millionMontenegro
1-OctHarrisons; Norton Rose FulbrightHarrisons, working alongside international advisor Norton Rose Fulbright, advised Export Development Canada on a loan to Montenegro for the purchase of Bell helicopters.EUR3millionMontenegro
25-DecHarrisonsHarrisons advised the AFD (Agence Francaise de Developpement) on a credit line to the Investment and Development Fund of Montenegro (IDF) in order to enable IDF to strengthen its financings of environmental, efficacy, and renewable energy sources projects.EUR50millionMontenegro
24-AprPolenak Law FirmPolenak advised Eurolink Osiguruvanje AD Skopje on its sale of 100% shares to GRAWE.N/ANorth MacedoniaHere
7-MayPolenak Law FirmThe Polenak Law Firm advised the EBRD in a EUR 2.5 million loan to Ohridska Banka AD Skopje under the Green Economy Financing Facility program, which is supported by the EU, Austria, and Western Balkans Investment Framework.EUR2.5millionNorth MacedoniaHere
24-JulPolenak Law FirmPolenak advised the EBRD on a EUR 20 million loan to Sparkasse Bank Makedonija.EUR20millionNorth MacedoniaHere
31-JulLaw Office Karmen Rebesco; Polenak Law FirmThe Polenak Law Firm advised NLB Bank Skopje as mandated lead arranger, agent, and lender on a EUR 72 million syndicated loan to East Gate to finance the construction of the East Gate Mall in Skopje. Law Office of Karmen Rebesco prepared the LMA finance documents and advised NLB dd. on the deal. East Gate was advised by solo practitioner Zeqir Zeqiri.EUR72millionNorth MacedoniaHere
5-AugODI LawODI Law advised FLO Magazacilik ve Pazarlama A.S on the opening of stores in Skopje and Tetovo.N/ANorth MacedoniaHere
5-AugODI LawODI Law helped Exor N.V. obtain Macedonian merger clearance for its EUR 102.4 million acquisition of GEDi Gruppo Editoriale S.p.A. from CIR SpA.EUR102.4millionNorth MacedoniaHere
6-AugODI LawODI helped Nova Ljubljanska Banka obtain Macedonian merger clearance for the acquisition of 83.23% of the ordinary shareholding in Komercijalna Banka a.d. Beograd.N/ANorth MacedoniaHere
1-SepBaker & McKenzie; Karanovic & PartnersKaranovic & Partners, working with international counsel Baker McKenzie, advised the Giesecke & Devrient Group on its acquisition of a shareholding interest in the Netcetera Group AG, including its subsidiary in North Macedonia.N/ANorth Macedonia
1-JanWardynski & PartnersWardynski & Partners advised CMC Poland sp. z o.o. on its acquisition of all shares in Ecosteel sp. z o.o. from a group of private individuals.N/APoland
2-JanMrowiec Fialek & PartnersMrowiec Fialek and Partners advised OCRK Sp. z o.o., a Polish portfolio company of Innova Capital, on the acquisition of a majority stake in Marcos Bis from unnamed sellers.N/APolandHere
2-JanCMSCMS advised Allianz Real Estate and Curzon Capital Partners III, L.P. on the sale of the Warsaw Financial Center in Warsaw's financial district to the Czech Republic's CPI Property Group.N/APolandHere
2-JanDentons; Greenberg TraurigDentons advised commercial real estate investor and developer Globe Trade Centre on its sale of shares in GTC Neptune Gdansk Sp. z o.o. - the owner of the Neptun Office Center in Gdansk. Greenberg Traurig advised the unnamed buyers.N/APolandHere
6-JanDLA Piper; WBW Weremczuk Bobel & WspolnicyDLA Piper advised Resource Partners on its acquisition of a majority stake in Maced, a family-owned dog treats and snacks producer in Polanow, Poland. Maced was advised by WBW Weremczuk, Bobel & Wspolnicy.N/APolandHere
6-JanWhite & CaseWhite & Case advised P4, the operator of Polish mobile network Play, on the launch of a bond issue program with a total nominal value of PLN 2 billion, as well as on the first issuance under the program of unsecured bearer bonds with a total nominal value of PLN 750 million.PLN2billionPolandHere
7-JanGessel; Kasprzyk & WojdanGessel advised BNP Paribas Bank Polska S.A. on its unspecified participation in Dafo Plastics S.A.'s recent financing round. Dafo Plastics was advised by Kasprzyk & Wojdan.N/APolandHere
7-JanCzabanski & GaluszynskiCzabanski & Galuszynski advised Bank Gospodarstwa Krajowego on its loan of almost PLN 50 million to an unidentified special purpose vehicle to finance the costs of the construction of a warehouse complex in Poland.PLN50millionPolandHere
13-JanNoerr; White & CaseNoerr advised TAG Immobilion on the acquisition of Polish real estate developer Vantage Development S.A. White & Case advised Vantage Development.EUR131millionPoland
15-JanCMS; DZP Domanski Zakrzewski PalinkaCMS advised Poland's Local Government Investment Fund on its acquisition of 45% shares in Tarnobrzeskie Wodoci_gi sp. z o.o., a water supply company in Tarnobrzeg, Poland. Tarnobrzeskie Wodociagi and the Municipality of Tarnobrzeg were advised by Domanski Zakrzewski Palinka.N/APolandHere
16-JanOrrick; SSW Pragmatic SolutionsOrrick and SSW Pragmatic Solutions advised Commercial Metals Company Poland on the completion of a ten-year financial (synthetic) power purchase agreement with renewable energy generator Statkraft.N/APoland
17-JanAct (BSWW)Act BSWW advised the Buma Group on the construction of the Wadowicka 3 real estate project in Krakow.N/APolandHere
17-JanLinklatersLinklaters advised Glamox AS, a Triton portfolio company, on its successful public tender offer to acquire 98.21% of the shares of Polish lighting solution provider ES-System.N/APolandHere
17-JanLinklatersLinklaters advised Resi4Rent on the acquisition of an apartment building in Wroclaw, Poland from Echo Investment. The financing of the building's construction was provided by a consortium led by Bank Pekao.N/APolandHere
17-JanLinklatersLinklaters advised UBM Development AGon the forward sale of hotel properties in Krakow and Katowice to Union Investment Institutional Property GmbH.N/APolandHere
17-JanBird & BirdBird & Bird advised Bank of China Luxembourg S.A, Poland and Luxembourg branches, on financing worth over EUR 120 million provided to two unnamed entities.EUR120millionPolandHere
17-JanAllen & Overy; Gide Loyrette NouelGide Loyrette Nouel advised KGHM Polska Miedz S.A. on a December 20, 2019 credit facility agreement in the amount of USD 1.5 billion with a consortium of banks including Bank Polska Kasa Opieki, Powszechna Kasa Oszczednosci Bank Polski, Intesa Sanpaolo, and Santander Bank Polska. The banks were advised by Allen & Overy.USD1.5billionPolandHere
20-JanClifford ChanceClifford Chance advised a consortium of Bank Pekao, PKO BP, Santander Bank Polska, and BNP Paribas Bank Polska on LPP S.A.'s bond issue program of up to PLN 300 million.PLN300millionPolandHere
21-JanDLA PiperDLA Piper advised FIZAN Foreign Expansion Fund on its investment in PGM, a Texas firm specializing in the treatment of used automotive and industrial catalytic converters.N/APolandHere
21-JanDZP Domanski Zakrzewski PalinkaDomanski Zakrzewski Palinka advised OGP Gaz-System S.A. on a project involving the creation of a new gas supply corridor on the European market.N/APolandHere
21-JanDWF; WKB Wiercinski Kwiecinski BaehrDWF advised the H.I.G. Capital private equity fund on its acquisition of 100% of shares in Meyra Group S.A. from the Avallon and Euro Choice IV funds. WKB Wiercinski Kwiecinski Baehr advised the sellers.N/APoland
21-JanEversheds SutherlandWierzbowski Eversheds Sutherland advised ELMO on the sale of an organized part of its enterprise to Solutions 30 Holding.PLN60millionPolandHere
23-JanDLA PiperDLA Piper advised FIZAN Foreign Expansion Fund on the acquisition by its Recat subsidiary of a minority block of shares in Tesla Recycling from the Elemental Holding group. Elemental was advised by solo practitioner Maria Janicka.N/APolandHere
24-JanGesselGessel advised Avallon on the acquisition of a majority stake in Clovin S.A.N/APolandHere
24-JanJankowski & Stroinski; Kondracki Celej; Studnicki, Pleszka, Cwiakalski, GorskiSPCG advised BNP Paribas on its investment, made with Alior Bank and PKO Bank Polski and in agreement with existing investors Innovation Nest and Black Pearls, in Autenti, a Polish Fintech platform for paperless electronic contract signing and digital document circulation. PKO was advised by Jankowski & Stroinski and Alior Bank by Kondracki Celej.PLN17millionPolandHere
27-JanMrowiec Fialek & PartnersMrowiec Fialek and Partners helped Lime Access sp. z o.o. find an investor and execute an investment agreement.N/APolandHere
27-JanAllen & Overy; Dentons; Studnicki, Pleszka, Cwiakalski, GorskiDentons and Studnicki Pleszka, Cwiakalski, Gorski advised French renewable energy producer Akuo Energy on financing it received for the construction of three wind farms from the Mirova Eurofideme 4 fund and a consortium of BNP Paribas Bank Polska, Commerzbank, and mBank. The banks were advised by Allen & Overy.N/APolandHere
28-JanDentons; LinklatersLinklaters advised Chariot Group B.V. on the sale of DIY stores leased by OBI located in Gdansk and Lodz to a subsidiary of Marr Holdings, a company from the Republic of South Africa. Dentons advised the buyers.N/APolandHere
28-JanKochanski & PartnersKochanski & Partners advised Visa Inc. on its launch of open banking services in Poland.N/APolandHere
28-JanDLA Piper; Greenberg TraurigDLA Piper advised asset management company KGAL Group on its purchase of the Prosta Office Center in Warsaw from Prosta Investments. Greenberg Traurig advised the sellers.N/APolandHere
28-JanDentonsDentons advised Erste Group Bank AG and mBank S.A. on refinancing the acquisition of Polish solar projects with a capacity of 46 MW granted to a project company controlled by Aberdeen Standard Investments's fund.N/APolandHere
28-JanDorsey & Whitney; Fieldfisher; Wardynski & PartnersWardynski & Partners, working alongside Fieldfisher, advised Descartes Systems UK Limited on its acquisition of Peoplevox Ltd. Dorsey & Whitney advised the seller.N/APoland
29-JanDZP Domanski Zakrzewski PalinkaDomanski Zakrzewski Palinka advised the Ingka Group on a merger of its IKEA Retail and IKEA Property Poland subsidiaries in Poland.N/APolandHere
29-JanGreenberg Traurig; Rymarz ZdortGreenberg Traurig advised Madison International Realty on its acquisition of a 46.5% stake in European Logistics Investment, which holds a Polish real estate warehouse portfolio valued at approximately EUR 500 million, from its majority owner Redefine Properties Limited. Rymarz Zdort advised Redefine on the transaction.N/APolandHere
29-JanEversheds Sutherland; Ignition LawEversheds Sutherland advised Cogito Capital Partners on its investment in London-based Applica.AI ltd and its subsidiary Applica.AI sp.z.o.o., a software company and a developer of AI-based robotic text automation platform. Applica was advised by Ignition Law.N/APolandHere
29-JanDLA Piper; GesselGessel advised Polish Enterprise Fund VII, a private equity fund managed by Enterprise Investors, on the sale of Danwood Holding to GS Engineering & Construction.EUR140millionPolandHere
30-JanKondrat & PartnersKondrat & Partners successfully represented the interests of the Warsaw School of Economics in a ten-year long dispute with the International Olympic Committee.N/APolandHere
30-JanMrowiec Fialek & PartnersMrowiec Fialek and Partners advised Centrum Rozliczen Elektronicznych Polskie ePlatnosci S.A., a portfolio company of Innova Capital, on the acquisition of Poznan-based TopCard.N/APolandHere
30-JanNoerr; White & CaseWhite & Case advised the Polish Aviation Group, which owns LOT Polish Airlines, on the acquisition of Germany's Condor Flugdienst GmbH. The sellers, UK's Thomas Cook, were advised by Noerr.N/APolandHere
30-JanKochanski & PartnersKochanski & Partners helped Global Primex obtain clearance from the Polish Financial Supervision Authority to introduce the Vload eVoucher within the European Union.N/APolandHere
30-JanJacek Kosinski Adwokaci i Radcowie PrawniJacek Kosinski Adwokaci i Radcowie Prawni helped PGE Baltica obtain environmental permits to construct two offshore wind farms from the Regional Director for Environmental Protection in Gdansk.PLN30billionPolandHere
31-JanDLK LegalDLK Legal advised Nest Bank S.A. on the launch of Nest Bank API - a project in which the bank provides FinTech firms and other institutions with an interface for integrating their services with its own.N/APolandHere
31-JanSSW Pragmatic SolutionsSSW Pragmatic Solutions advised Venture Capital fund Cofounder Zone on its acquisition of an undefined stake in Ekobilet S.A., the owner of a technology platform for selling tickets for artistic and sporting events.N/APolandHere
31-JanDentons; PenterisPenteris advised Apollo Rida on the acquisition of the Equal Business Park in Krakow from Cavatina Holding. Dentons advised the sellers.N/APolandHere
31-JanDLA PiperDLA Piper advised OEX on the buy-back of its shares.PLN8millionPolandHere
31-JanPaul Hastings; WKB Wiercinski Kwiecinski BaehrWKB advised the Intel Corporation on Polish aspects of its acquisition of Habana Labs, an Israeli company specializing in the design of processors for machine learning and artificial intelligence applications. Paul Hastings was global counsel to the Intel Corporation on the deal.USD2billionPolandHere
1-FebCMS; NoerrNoerr advised Globe Trade Centre on the refinancing of the Galeria Jurajska shopping center in Poland by Erste Group Bank AG and Raiffeisenlandesbank Niederosterreich-Wien. CMS advised the lenders.EUR130millionPoland
4-FebCzabanski & GaluszynskiPoland's Czabanski & Galuszynski law firm represented the AXA Association pro bonoin an unspecified dispute before Administrative courts.N/APolandHere
4-FebGreenberg TraurigGreenberg Traurig advised Wood & Co. as the sole global coordinator on an accelerated book-building process acquisition of 13.3% shares in Ten Square Games S.A. from its management board members Maciej Popowicz and Arkadiusz Pernal.PLN220millionPolandHere
5-FebDLA Piper; Domanski Zakrzewski PalinkaDLA Piper advised Polish family-owned investment firm TDJ on its acquisition of a controlling 83% stake in Teamtechnik Production Technology, a company specializing in the design and manufacture of intelligent production lines for the automotive industry. Teamtechnik was advised by Domanski Zakrzewski Palinka.N/APolandHere
6-FebKochanski & PartnersKochanski & Partners advised Formaster S.A. on its merger by absorption of subsidiaries Dafi Pro S.A. and Dafi Market S.A..N/APolandHere
7-FebDentonsDentons helped Toshiba Carrier Corporation establish its first European manufacturing site in Poland.N/APolandHere
7-FebGreenberg Traurig; LinklatersGreenberg Traurig advised Tritax EuroBox on its acquisition of Central Logistics Investment from Griffin Real Estate, which was acting on behalf of Redefine Properties. Linklaters advised the sellers on the deal.N/APolandHere
7-FebRadzikowski, Szubielska I Wspolnicy; SSW Pragmatic SolutionsSSW Pragmatic Solutions advised White Stone Development on a loan it received from Santander Bank Polska. Radzikowski, Szubielska I Wspolnicy reportedly advised Santander Bank Polska.N/APolandHere
7-FebCMSCMS advised the Partners Group on its acquisition of a majority share of the VSB Group.EUR1.3billionPolandHere
10-FebClifford Chance; White & CaseClifford Chance advised INEA, an open-access fiber-optic network operator in Poland, on additional financing procured from a consortium of Bank Pekao S.A., Credit Agricole Bank Polska S.A., Credit Agricole Corporate and Investment Bank, EBRD, ING Bank Slaski S.A., PKO BP S.A., BNP Paribas Bank Polska S.A., and PZU Fizan BIS 1. White & Case advised the lenders.PLN400millionPolandHere
11-FebEversheds SutherlandEversheds Sutherland Wierzbowski is advising the Polish Ministry of Finance and Polish Financial Supervision Authority on a project titled "On the Road to Financial Inclusion and Innovation," which is designed to establish a legal and technological framework for developing the FinTech and SupTech sector in Poland. The project also involves the EBRD, among others.N/APolandHere
11-FebEversheds Sutherland; WKB Wiercinski Kwiecinski BaehrEversheds Sutherland Wierzbowski advised IGT Global Services on the sale of 100% of the shares of BillBird to Centrum Rozliczen Elektronicznych Polskie ePlatnosci. Wiercinski, Kwiecinski, Baehr advised the buyers on the deal.N/APolandHere
12-FebAllen & Overy; DLA Piper; Greenberg Traurig; Norton Rose Fulbright; Rymarz ZdortNorton Rose Fulbright advised the banks on financing provided to Vectra S.A. for its acquisition of Multimedia Polska S.A. Vectra was advised by Rymarz Zdort. Multimedia Polska was advised by Allen & Overy, while DLA Piper advised the shareholders of Multimedia Polska. Multimedia Polska's creditors were advised by Greenberg Traurig.N/APolandHere
12-FebSSW Pragmatic SolutionsSSW Pragmatic Solutions advised SkinWallet on its receipt of PLN 3.4 million in financing from multiple unidentified investors.PLN3.4millionPolandHere
13-FebCMS; Solivan Pontes; Studnicki, Pleszka, Cwiakalski, GorskiCMS advised MEAG, a German renewable industry investor, on its acquisition of a 21 MW wind farm project located in Zary, in Western Poland, from Sweden's OX2 Wind International AB. The sellers were advised by Solivan and Studnicki, Pleszka, Cwiakalski, Gorski.N/APolandHere
13-FebDeloitte Legal; Kancelaria Kurek Wojcik; SchoenherrSchoenher and Kancelaria Kurek Wojcik advised Europejski Fundusz Leasingowy SAĂŠ on its acquisition of a 70% stake in Hama Polska Sp. z o.o. Deloitte Legal advised the sellers.N/APoland
13-FebGreenberg Traurig; LinklatersGreenberg Traurig advised Union Investment on a preliminary agreement to acquire planned hotel properties in Katowice (the Hotel Mercure) and Krakow (the Hotel Ibis Styles) from UBM Development. Linklaters advised UBM Development on the transaction.EUR86millionPolandHere
14-FebBalicki Czekanski Gryglewski Lewczuk; SSW Pragmatic SolutionsSSW Pragmatic Solutions advised Unilink S.A. on its acquisition of a majority stake in Damo Ubezpieczenia. The sellers were advised by BCGL.N/APolandHere
17-FebDecisive Worldwide Szmigiel Papros GregorczykDecisive Worldwide advised the ENEL MED group on its lease of medical clinics in the Centrum Zana in Gdansk and in the React building in Lodz.N/APolandHere
18-FebSSW Pragmatic SolutionsSSW Pragmatic Solutions advised the owner of Kospel S.A. on the sale of the company to the Viessmann Group.N/APolandHere
18-FebKondrat & PartnersKondrat & Partners successfully represented KA sp. z o.o. in a dispute with Poland's Chief Pharmaceutical Inspectorate in Warsaw regarding KA's preparation of homeopathic medicines on commission for another pharmacy.N/APolandHere
19-FebAct (BSWW)Act BSWW advised Adventum International on the acquisition of the Katowice Business Point building in Katowice.N/APolandHere
19-FebGreenberg TraurigGreenberg Traurig advised Cyfrowy Polsat on the issuance of Series C green bonds with an aggregate nominal value of PLN 1 billion.PLN1billionPolandHere
20-FebAct Legal (BSWW)Act BSWW advised MK Holding Sarl on a joint venture with a company in theDeA Capital Group, an Italian investment group focusing on real estate and equity investments.N/APolandHere
20-FebArgon Legal; Decisive Worldwide Szmigiel Papros GregorczykDecisive Worldwide advised Orsted Polska on its lease of office space in Warsaw's Varso Space Complex from CHM 1, which was advised by Argon Legal.N/APolandHere
20-FebJara Drapala & Partners; WKB Wiercinski Kwiecinski BaehrJara Drapala & Partners advised Bas Lease B.V. on cross-border financing granted to Boekestijn Transport Holding B.V. for its acquisition of Baltic Trans sp. z o.o. from ECS Corporate N.V. WKB advised Boekestijn Transport on both the financing and the acquisition.N/APolandHere
20-FebKancelarii Kulicki; Kondracki Celej; OrrickOrrick and Kondracki Celej advised Dogmates (trading as Butternut Box) on its investment into the USD 400,000 financing of PsiBufet, a Poland-based home-made dog food manufacturer. Kancelarii Kulicki advised PsiBufet.USD400000Poland
21-FebGide Loyrette Nouel; Wardynski & PartnersGide advised B&B Hotels Polska on a cooperation agreement with Covivio and on the sale and leaseback of three hotels. Covivio was advised by Wardynski & Partners.N/APolandHere
21-FebLinklatersLinklaters advised Panattoni Europe on negotiating the terms of a lease of nearly 6,500 square meters of space in the Panattoni Park Gorzow logistics park to Omnipack.N/APolandHere
24-FebDentons; Kwasnicki, Wrobel & Partners; Rymarz ZdortRymarz Zdort advised a joint venture of a fund managed by the Real Estate Group of Ares Management Corporation and Griffin Real Estate on its acquisition of 98.04% of the shares in residential property developer Murapol. RKKW advised Murapol on the deal, and Dentons advised the Cavatina real estate company on the sale of its stake in Murapol.N/APolandHere
24-FebClifford Chance; Greenberg TraurigGreenberg Traurig advised REINO RF CEE Real Estate, a Luxembourg-based fund created by REINO Capital and Australia's CorVal, on its preliminary agreement to acquire the entire BUMA Group real estate portfolio. Clifford Chance advised the BUMA group.PLN1.3billionPolandHere
25-FebClifford Chance; White & CaseWhite & Case advised the Polish Ministry of Finance on its issuance of EUR 1.5 billion five-year notes. Clifford Chance advised the consortium of banks that arranged the issuance, which included BNP Paribas, Commerzbank, ING, JP Morgan, PKO BP and Santander.EUR1.5billionPolandHere
25-FebLinklatersLinklaters advised Bain Capital Credit on a joint venture with real estate investment manager Corestate that resulted in Corestate's approximately EUR 73 million acquisition of the first Micro Living properties in Gdansk and Krakow for Bain Capital Credit.EUR73millionPolandHere
25-FebGreenberg Traurig; Hogan LovellsHogan Lovells advised the Akiem Group on the acquisition of Macquarie Europe Rail's rolling stock leasing business, including 137 locomotives, 110 carriages, and 46 trains. The seller was advised by Greenberg Traurig.N/APoland
26-FebWhite & CaseWhite & Case advised the European Investment Fund on a synthetic securitization project originated by Europejski Fundusz Leasingowy, a leasing company in the Credit Agricole Group.EUR490millionPolandHere
26-FebMrowiec Fialek & PartnersMrowiec Fialek and Partners advised Wroclaw-based Work Service S.A. on an investment agreement with Gi International.PLN210.2millionPolandHere
4-MarClifford Chance; Gessel; NoerrNoerr advised HKM Beteiligungs GmbH on the sale of Gratka sp. z o.o.to Ringier Axel Springer Media AG, which was advised by Clifford Chance. The deal also included a related transaction in which Ringier Axel Springer Media acquired MZN Property SA via tender offer. Gessel advised MZN minority shareholder Alterium Holding Sp. z o. o., on that deal.N/APolandHere
4-MarAndersen GlobalAndersen Tax & Legal helped the FCA Group alter the Polish structure of the banking arm of the FCA Bank, a joint venture of Fiat Chrysler Automobiles and Credit Agricole Consumer Finance.N/APolandHere
5-MarDLA Piper; Olesinski & WspolnicyDLA Piper advised Allegro on its acquisition of FinAi from its founders and from the Fidiasz FIZ investment fund. Olesinski & Wspolnicy advised Fidiasz on the deal.N/APolandHere
5-MarBenvalor; Jacek Kosinski Adwokaci I Radcowie Prawni; LXAJacek Kosinski Adwokaci i Radcowie Prawni, working with the Netherlands' Benvalor law firm, advised Shibumi, a Dubai-based venture capital company, on an unspecified investment in Sustonable, a sustainable building materials company which produces composite stone surfaces. Sustonable was advised by LXA.N/APoland
5-MarDentons; DLA PiperDLA Piper advised Santander Bank Polska, BNP Paribas Bank Polska, PKO Bank Polski, and Bank Pekao on a loan to HB Reavis for the development of the Forest office campus in Warsaw. Dentons advised HB Reavis on the deal.EUR162millionPoland
6-MarHogan LovellsHogan Lovells advised German real estate investment funds management company Patrizia Frankfurt on tax aspects of its sale of an office building in Warsaw.N/APolandHere
6-MarCMSCMS advised MZN Property S.A. and some of its shareholders on the acquisition of an unnamed strategic investor.N/APolandHere
9-MarAllen & Overy; Wolf TheissWolf Theiss advised Marvipol Development and PG Dutch Holding I on the sale by their joint venture special purpose vehicles of development plots in Warsaw and Michalowice to LaSalle Investment Management KVG. Allen & Overy advised the buyer on the deal.EUR29.6millionPolandHere
10-MarDe Brauw Blackstone Westbroek; Dechert; Homburger; McDermott Will & Emery; Paul, Weiss, Rifkind, Wharton & Garrison; Schoenherr; TorysSchoenherr, De Brauw Blackstone Westbroek, and Paul Weiss Rifkind Wharton & Garrison advised Apollo Global Management, LLC on its acquisition of Covis Pharma BV from a group of sellers, including Cerberus Capital Management, L.P. and Princeton BioPharma Capital Partners LLC. Dechert, McDermott Will & Emery, and Torys advised Covis Pharma, as the target of the deal. Dechert and Homburger advised the sellers on the deal.N/APoland
10-MarEversheds SutherlandEversheds Sutherland advised EEC Magenta on its investment of PLN 10 million in Sinterit Sp. z o.o.PLN10millionPolandHere
11-MarGesselGessel successfully represented Polish citizen Wladyslaw Frasyniuk against charges he violated the physical integrity of police officers.N/APolandHere
11-MarSSW Pragmatic SolutionsSSW Pragmatic Solutions helped Games Operators obtain the approval of the Polish Financial Supervision Authority for its prospectus.N/APolandHere
12-MarSSW Pragmatic SolutionsSSW Pragmatic Solutions advised V&P sp. z o.o. on the company's investment policy and investment strategy and represented V&P in proceedings before the Polish Financial Supervisory Authority, resulting in the company's successful registration as an Alternative Investment Funds Manager.N/APolandHere
13-MarDLA PiperDLA Piper advised Polnord, a residential development company in Poland, on its EUR 31.7 million public offering.EUR31.7millionPolandHere
18-MarDentons; Greenberg TraurigGreenberg Traurig advised Heitman on the sale of the Marynarska Business Park A-class office building complex in Warsaw to Benson Elliot. Dentons advised the buyers on the deal.N/APolandHere
18-MarSoltysinski Kawecki & SzlezakSoltysinski Kawecki & Slezak successfully represented the interests of Polimex-Mostostal before the Court of Appeal in Katowice, Poland, in a dispute against the City of Katowice.PLN40.4millionPolandHere
19-MarAct Legal (BSWW); Clifford Chance; Domanski Zakrzewski Palinka; Oles & RodzynkiewiczAct BSWW advised the Management Boards of the Buma Group companies on the sale of its real estate assets to Reino RF CEE Real Estate, a joint venture established by Reino Capital and RF CorVal International Holdings Limited. Clifford Chance, Domanski Zakrzewski Palinka, and Oles & Rodzeynkiewicz advised the sellers on the deal, while Greenberg Traurig advised the buyers.N/APolandHere
19-MarRymarz Zdort; White & CaseRymarz Zdort advised Innova Capital and OPTeam on the sale of Centrum Rozliczen Elektronicznych Polskie ePlatnosci to Rementi Investments. White & Case advised Rementi Investments on the transaction.N/APolandHere
19-MarMoore Blatch; Zieba & PartnersZieba & Partners advised Gamma Communications on Polish Law aspects of its acquisition of Exactive Holdings Limited. England's Moore Blatch advised Exactive.N/APolandHere
19-MarDomanski Zakrzewski PalinkaDomanski Zakrzewski Palinka advised TECS Telecommunication & e-Commerce Solutions GmbH on a tender for the implementation of a project for handling cashless payments and settling transactions in the Electronic Toll Collection System that was conducted by Poland's General Inspectorate of Road Transport.N/APolandHere
19-MarStudnicki, Pleszka, Cwiakalski, GorskiSPCG persuaded the District Court in Gdansk to rule in favor of its client, Talia Sp. z o.o., in a claim against Polska Energia - First Kompania Handlowa sp. z o. o.N/APolandHere
23-MarDentons; PenterisPenteris advised Immofinanz on its sale of the Equator I office building in Warsaw to CPI Property Group. Dentons advised the buyers on the deal.N/APolandHere
23-MarDentonsDentons helped Pro Patria Electronics win a public contract bid to deliver 104 battlefield reconnaissance radar sets in Poland.N/APolandHere
23-MarThommessen Law Firm; Zieba & PartnersZieba & Partners advised EG A/S on its acquisition of Holte AS. Norway's Thommessen Law advised the sellers on the deal.N/APolandHere
24-MarSMM LegalSMM helped Energa-Obrot S.A. settle its seventh and final dispute in a series of conflicts involving green certificates for wind farms with unnamed business partners.N/APolandHere
27-MarDentons; DLA PiperDLA Piper advised Elite Partners Capital on the purchase of a five-warehouse logistics park covering more than 200,000 square meters in the south-west of Warsaw, from P3 Mszczonow. Dentons advised the sellers.N/APolandHere
30-MarDentons; Greenberg TraurigGreenberg Traurig advised Deka Immobilien on the acquisition of the Generation Park Z office building from Skanska. Dentons advised Skanska.N/APolandHere
2-AprDomanski Zakrzewski PalinkaDomanski Zakrzewski Palinka and solo practitioner Marzena Juskiewicz successfully represented the City of Krakow Road Administration before Poland's National Appeal Chamber regarding a PPP project involving the design, construction, and operation of part of a tramway.N/APolandHere
3-AprRadzikowski, Szubielska i WspolnicyRadzikowski, Szubielska i Wspolnicy advised ZPUE on a PLN loan of 180 million it received from, among others, Santander Bank, Citihandlowy-Bank Handlowy w Warszawie, and ING Bank Slaski.PLN180millionPolandHere
3-AprDentonsDentons advised CPI Property Group on its acquisition of the Moniuszki 1A office building in Warsaw from Canadian investment fund Catalyst Capital.EUR800millionPolandHere
9-AprBaker Mckenzie; DentonsDentons advised Hines Poland Sustainable Income Fund on the sale of a portfolio of six Polish distribution parks and the Nord Point office building in Warsaw to Chinese investor CGL Investment Holdings Corporation Limited. Baker McKenzie advised the buyers.N/APolandHere
9-AprClifford Chance; LinklatersClifford Chance advised a consortium of banks including Intesa Sanpaolo Oddzia_ w Polsce as lender and paying agent, Banca IMI, London Branch and China Construction Bank Oddzial w Polsce as mandated lead arrangers and bookrunners, and Banca IMI S.p.A. as facility agent on a PLN 500 million syndicated loan to Tauron Polska Energia. Linklaters advised Tauron Polska Energia.PLN500millionPolandHere
14-AprDentonsDentons advised Savills Investment Management on its acquisition of the Leroy Merlin distribution center near Lodz from Invesco Real Estate. The purchase, which was valued at approximately EUR 71 million, was made on behalf of Korean institutional investors managed by Vestas Investment Management.EUR71millionPolandHere
17-AprGreenberg Traurig; LinklatersGreenberg Traurig advised IAD Investments on its acquisition of the company holding the D48 office building in the Mokotow district of Warsaw from Penta Real Estate. Linklaters advised the sellers on the deal.N/APolandHere
20-AprMrowiec Fialek & PartnersMrowiec Fialek and Partners advised Yuniversal Development on the issuance of PLN 4 million in corporate bonds.PLN4millionPolandHere
21-AprClifford Chance; Dentons; Kancelaria Kurek WojcikDentons advised a fund managed by GLL Real Estate Partners on the acquisition of a logistic center in Kokotow, Poland, from a joint venture of 7R S.A. and Hillwood Polska. KKW advised 7R and Clifford Chance advised Hillwood Polska on the deal.N/APolandHere
22-AprCMS; Gide Loyrette NouelCMS advised Amundi Real Estate on its acquisition of Nowogrodzka Square, a Class A office and retail building in Warsaw, from Polish property developer Yareal. Gide Loyrette Nouel advised Yareal.N/APolandHere
22-AprRymarz ZdortRymarz Zdort advised PSP, the operator of the BLIK mobile payment system, on the addition of Mastercard as an investor and the start of commercial collaboration between it and PSP.N/APolandHere
22-AprSSW Pragmatic SolutionsSSW Pragmatic Solutions advised Orlen Poludnie on its launch of a second generation bioethanol plant at its refinery in Jedlicze, Poland.N/APolandHere
23-AprDLA Piper; Rymarz ZdortRymarz Zdort advised Cordia International on its PLN 229.4 million acquisition of a majority stake in Polnord S.A. DLA Piper advised Polnord on the deal.PLN229.4millionPolandHere
24-AprSSW Pragmatic SolutionsSSW Pragmatic Solutions assisted Games Operators with its initial public offering and listing on the Warsaw Stock Exchange.N/APolandHere
27-AprCMSCMS advised Real Assets Advisers on its joint acquisition of 33% of Acciona Energia Internacional by AXA Real Asset and Acciona S.A.N/APolandHere
27-AprWhite & CaseWhite & Case advised PKO Bank Polski on a tender offer to the holders of its EUR 750 million notes and USD 1 billion notes issued by its subsidiary, PKO Finance AB.EUR1.2billionPolandHere
28-AprDentons; Rymarz ZdortDentons advised ING Bank Slaski on a multimillion acquisition financing and refinancing of a portfolio of Polish solar projects with an aggregate capacity of 45 MW. The financing was granted to a project company controlled by a fund managed by Aberdeen Standard Investments, which was advised by Rymarz Zdort.N/APolandHere
28-AprJacek Kosinski Adwokaci i Radcowie PrawniJacek Kosinski Adwokaci i Radcowie Prawni advised Dubai-based VC Shibumi International on its investment in Hustro, a Wroclaw-based company that operates in the construction sector. Hustro was advised by solo practitioner Maksymilian Imbirski.N/APolandHere
29-AprFieldfisher; RJPartners; Wardynski & PartnersWardynski & Partners, working alongside Italian counsel Fieldfisher, advised Cefla s.c. on its acquisition of 51% of the shares in Stern Weber Polska sp. z o.o. The sellers were assisted by RJPartners.N/APoland
30-AprBech-Bruun; Link Legal; Soltysinski Kawecki & Szlezak; Wardynski & Partners; Wikborg ReinWardynski & Partners, working alongside Gorrissen Federspiel, advised Leica Geosystems (part of Hexagon) on its acquisition of the aerial mapping business of international consulting group COWI. COWI was assisted by Wikborg Rein, Bech-Bruun, SK&S Legal, and Link Legal.N/APoland
30-AprAllen & Overy; Hogan LovellsHogan Lovells advised Metro Warszawskie Sp. z o. o. on credit facilities it obtained for new infrastructure and the purchase of new environment-friendly rolling stock, as well as on the negotiation of a new public service agreement. The financing in the amount of up to PLN 654 million will be provided by the European Investment Bank. Allen & Overy advised the lender.PLN654millionPoland
1-MayBrockhuis Jurczak Prusak Sroka Nilsson; Radzikowski, Szubielska I WspolnicyBSJP advised European Energy, a Denmark-based constructor of wind and solar farms as well as large-scale green energy storage facilities, on an acquisition of a Polish wind farm investment project with a total nominal wind capacity of 48 MW. Radzikowski, Szubielska I Wspolnicy advised the sellerN/APoland
1-MayBrockhuis Jurczak Prusak Sroka NilssonOn behalf of European Energy, a Denmark-based constructor of wind and solar farms as well as large-scale green energy storage facilities, BSJP negotiated the rights to the acquisition of a large-scale photovoltaic installation in Poland with a total nominal capacity of 150 MW.N/APoland
1-MayBech-Bruun; Kromann Reumer; Wardynski & Partners; White & CaseWardynski & Partners, working alongside Kromann Reumert, advised the Orifarm Group pharmaceutical company on the acquisition of a portfolio of select over-the-counter and prescription pharmaceutical products from Takeda Pharmaceutical Company Limited. White & Case and Bech-Bruun advised the sellers.USD670millionPoland
4-MaySSW Pragmatic SolutionsSSW Pragmatic Solutions advised Link4 TU S.A. on the implementation of a blockchain-based project that will allow the company to, in the firm's words, "meet the requirements set by the regulator in the area of providing clients with documents, and save costs through digitization."N/APolandHere
5-MayCMS; SchoenherrCMS advised PZ Cussons on the sale of LUKSJA, a Polish personal care cosmetics brand, to the Sarantis Group. Schoenherr advised Sarantis on the deal.N/APolandHere
5-MayGreenberg Traurig; NoerrGreenberg Traurig has advised the Polsat Group on its acquisition of Interia Group from Bauer Media Group. Noerr advised the sellers on the deal, which remains subject to regulatory approval.N/APolandHere
5-MaySSW Pragmatic SolutionsSSW Pragmatic Solutions advised Zedra Malta Limited on the acquisition of Poland's Awans Corporate Services.N/APolandHere
6-MayDomanski Zakrzewski PalinkaDomanski Zakrzewski Palinka advised Gas-System SA on a construction and assembly agreement with Saipem Limited regarding the laying of the Baltic Pipe intersystem gas pipeline on the bottom of the Baltic Sea and connecting the undersea part of the pipeline with onshore sections in Poland and Denmark.N/APolandHere
6-MayGreenberg TraurigGreenberg Traurig helped Zygmunt Solorz, the founder and majority shareholder of Grupa Polsat, purchase 200 thousand genetic tests to be used by all Ministry of Health laboratories in Poland to diagnose the coronavirus.PLN16millionPolandHere
7-MayRymarz ZdortRymarz Zdort advised Griffin Real Estate and European Logistics Investment BV on the acquisition of land and the construction of warehouses in the Polish communities of Ruda Slaska, Czeladz, and Torun, from Panattoni Development Europe.N/APolandHere
8-MayDentons; Wozniak LegalDentons advised the CPI Property Group on its acquisition of a 50.3% share in the ownership of the Chalubinskiego 8 office building in Warsaw from First Property Group. Wozniak Legal advised the sellers on the deal.N/APolandHere
8-MayMarekwia & Plawny; NoerrNoerr advised environmental service provider PreZero on its acquisition of 100% of the shares of Komart, a Polish provider of municipal and industrial waste management services. Marekwia & Plawny advised the unidentified sellers on the deal.N/APolandHere
11-MayGreenberg TraurigGreenberg Traurig advised CCC and its main shareholder on issuing and offering 13.7 million new shares.PLN500millionPolandHere
14-MaySMM LegalSMM Legal helped the Polish National Center for Research and Development launch the "Grand Challenge: Energy" project.N/APolandHere
15-MayKwasnicki, Wrobel & PartnersKwasnicki Wrobel & Partners advised Lorentz Tech Limited on the acquisition of Cube ID, a Polish company specializing in identity management products.N/APolandHere
15-MayAllen & OveryAllen & Overy advised the Polish Development Fund on the implementation of Poland's "PFR Financial Shield for Small and Medium-Sized Enterprises" program that is designed to provide financial support for enterprises following the outbreak of the COVID-19 coronavirus pandemic.N/APolandHere
18-MayBird & BirdBird & Bird won the right to advise the Solidarity Transport Hub on its selection of key consultants for a new airport in Poland.N/APolandHere
18-MayGesselGessel advised Systexan SARL, a fund managed by Enterprise Investors, on its exit from X-Trade Brokers Dom Maklerski S.A., including its conducting a public offer in the form of accelerated book-building worth PLN 111.2 million. Global coordinators were PKO BP and Ipopema Securities.PLN111.2millionPolandHere
22-MayAct (BSWW)Act BSWW advised AFI Europe on a lease of 900 square meters of office space in the V.Offices complex in Krakow to BrainShare IT.N/APolandHere
22-MayClifford Chance; DWFDWF advised Solaque Holding Ltd. on the sale of two wind farms in Poland to Fonnes sp. z o.o., a subsidiary of Taaleri Plc. Clifford Chance advised the buyers on the deal.N/APolandHere
26-MayWhite & CaseWhite & Case advised Kenbourne Invest II and Tollerton Investments Limited on the PLN 700 million sale of shares in Play Communications. BofA Securities and Santander Bank Polska S.A. - Santander Biuro Maklerskie acted as joint global coordinators and joint bookrunners.PLN700millionPolandHere
28-MayDentons; Rymarz ZdortRymarz Zdort advised a company controlled by a fund managed by Aberdeen Standard Investments on the refinancing of one of its Polish photovoltaic portfolio with an aggregate capacity of 55 MW. Dentons advised Erste Group Bank AG and ING Bank Slaski S.A. on the refinancing.N/APolandHere
29-MayBCGL; GesselBCGL advised mBank S.A. on financing granted to PGB Holdco and its subsidiaries for the development and start-up of biogas plant facilities. Gessel advised PGB Holdco on the deal.N/APolandHere
4-JunAct (BSWW); Deloitte LegalAct BSWW advised the Adventum International investment fund on the acquisition of a 17,000-square-meter office building in Wroclaw, Poland, from EFL Service SA,, which is controlled by Europejski Fundusz Leasingowy SA. Deloitte Legal advised the sellers on the deal.N/APolandHere
4-JunCMS; Eversheds SutherlandEversheds Sutherland Wierzbowski advised the Lithuanian electricity transmission system operator on an agreement regarding the construction of the Harmony Link submarine cable between Lithuania and Poland. CMS advised Polish power transmission system operator PSE on the deal.N/APolandHere
4-JunAllen & Overy; Ellex (Valiunas)Ellex Valiunas advised Energy Solar Projekty sp.z o.o on its receipt of a EUR 36 million loan from the EIB and DNB Bank Polska. Allen & Overy advised DNB Bank Polska on the loan, which is designed for the development of a solar power plant project in Poland.EUR36millionPolandHere
4-JunBaker Mckenzie; CMS; DLA Piper; White & CaseCMS advised Grupa Azoty Polyolefins on financing it received from Grupa Lotos SA and South Korea's Hyundai Engineering and Korea Overseas Infrastructure & Urban Development Corporation for the Police Polimery polypropylene project in Poland, as well as on the implementation of the project. Baker McKenzie advised Grupa Lotos and DLA Piper advised Hyundai and Korea Overseas Infrastructure & Urban Development on the deal.USD1.20billionPolandHere
5-JunHogan Lovells; LinklatersLinklaters advised Swedish real estate private equity firm NIAM on the sale of Silesia Business Park A and B in Katowice to the Philippine's ISOC Group, represented in Poland by Augusta Cracovia, which was advised by Hogan Lovells.N/APolandHere
8-JunMGS LawMGS Law advised Orange Poland on two Power Purchase Agreements concluded with German renewable energy projects developer WPD regardingĂŠwind farms WPD will operate in Jarocin (5 MW) and Krotoszyn (10 MW).N/APolandHere
8-JunDWFDWF advised Polish Enterprise Fund VIII, a private equity fund managed by Enterprise Investors, on an unspecified investment in the Vehis Group.N/APolandHere
8-JunDentons; PenterisDentons advised commercial real estate developer Cavatina Holding on the sale of three A-class office buildings in the Equal Business Park office complex in Krakow to a consortium managed by Apollo-Rida Poland. Penteris advised Apollo-Rida on the deal.N/APolandHere
8-JunRymarz ZdortRymarz Zdort advised funds controlled by Aberdeen Standard Investments on the acquisition of a portfolio of 130 photovoltaic plants with a total capacity of 122 MW from Poland's R. Power Group.N/APolandHere
8-JunGide Loyrette NouelThe Warsaw office of Gide advised Archicom on its EUR 33.8 million sale of the City One office building in Wroclaw to an unnamed institutional investor.EUR33.8millionPolandHere
8-JunMrowiec Fialek & PartnersMrowiec Fialek & Partners advised Polski Holding Nieruchomosci S.A. on the issuance of E series shares and on their admission to trading on the Warsaw Stock Exchange.PLN4.2millionPolandHere
11-JunGide Loyrette Nouel; White & CaseGide Loyrette Nouel advised Sierra Gorda on its entrance into a credit facility agreement of USD 200 million with Bank Gospodarstwa Krajowego. Gide also advised corporate guarantors KGHM Polska Miedz S.A., Sumitomo Metal Mining Co. Ltd, and Sumitomo Corporation. White & Case advised Bank Gospodarstwa Krajowego on the deal.EUR200millionPolandHere
15-JunBird & Bird; SRCBird & Bird advised mBank on an unspecified financing and refinancing transaction related to the construction of 28 solar farms in northwestern Poland owned by seven SPVs belonging to Denmark's Nordic Solar. SRC advised Nordic Solar.N/APolandHere
15-JunJara Drapala & PartnersJDP helped a consortium composed of Intercor, Stecol, and Sinohydro to win a tender announced by PKP PLK S.A. and involving the construction of part of Rail Baltica, a railway corridor connecting Berlin, Warsaw, Kaunas, Riga, Tallinn and Helsinki.PLN4.1billionPolandHere
17-JunCK Legal; Decisive Worldwide Szmigiel Papros GregorczykDecisive Worldwide Szmigiel Papros Gregorczyk advised Rengl Polska Sp. z o. o. on its acquisition of the assets of Krakow's Wenecja Advertising Agency. CK Legal advised the sellers on the deal.N/APolandHere
18-JunNorton Rose FulbrightNorton Rose Fulbright advised a consortium of Polish banks consisting of mBank S.A. and Santander Bank Polska S.A. in relation to the financing of R. Power's 121 MWp PV installations in Poland.PLN350millionPolandHere
22-JunCMS; Rymarz ZdortRymarz Zdort advised a fund controlled by Aberdeen Standard Investments on its acquisition of a portfolio of 41 photovoltaic projects from Lithuania-based Green Genius. CMS advised Green Genius on the deal.N/APolandHere
23-JunGawronski & PartnersGawronski & Partners advised Przedsiebiorstwo Wodociagow i Kanalizacji on the organization of a public procurement procedure for the construction of a pioneer nutrient recovery facility designed torecover phosphorus from reclaimed water in a sewage treatment plant in the Polish town of Cielcza.N/APolandHere
23-JunLinklatersLinklaters advised Polish Logistics LLP on the acquisition and financing of a logistics park in Piotrkow Trybunalski, near Lodz, from unnamed sellers.N/APolandHere
23-JunSchnittker Moellmann Partners; SSW Pragmatic Solutions; Taylor WessingSSW Pragmatic Solutions, working with Germany's Schnittker Moellmann Partners, advised Polish private equity investor ARIA Private Equity on its investment in Inuru, a company providing electronic packaging solutions. Taylor Wessing advised Inuru on the transaction.EUR2millionPolandHere
23-JunDentons; LinklatersLinklaters advised the EBRD and BNP Paribas Bank Polska on financing provided to five Polish special purpose vehicles owned by the French renewable energy developer and operator Qair and the French infrastructure fund RGreen Invest and advised BNP Paribas Bank Polska on financing provided to three Polish special purpose vehicles of the same portfolio, with the total financing to the portfolio amounting to approximately PLN 700 million. Dentons advised Qair on the deal.PLN700millionPolandHere
24-JunCK LegalCK Legal advised Selvita S.A. on its successfully allotment of 2.38 million of C series shares, raising EUR 20.6 million from investors.EUR20.6millionPolandHere
26-JunGesselGessel advised Anwim on its investment in a network of unmanned eMila service stations.N/APolandHere
26-JunArena Legal; Gessel; Lewczuk Lyszczarek I WspolnicyGessel advised the Sunfish Partners fund on participating in an investment round, together with Chiratae Ventures and Joyance Partners, for Aether Biomedical. Lewczuk Lyszczarek I Wspolnicy advised Aether Biomedical on the deal, while Arena Legal had advised Chiratae Ventures and Joyance Partners.N/APolandHere
26-JunSSW Pragmatic SolutionsSSW Pragmatic Solutions advised CofounderZone, a venture capital fund managed by the state-owned PFR Ventures group, on its investment in Nethansa, a Polish startup offering the Clipperon system for automating logistics and sales processes on the Amazon platform.N/APolandHere
26-JunDWF; Skils; WKB Wiercinski Kwiecinski BaehrDWF advised the ESPF 4 fund managed by KGAL on the acquisition of two wind farms with a total capacity of 40 MW from the CEZ Group. WKB Wiercinski Kwiecinski Baehr and Skils advised CEZ on the deal.N/APolandHere
26-JunRymarz ZdortRymarz Zdort advised European Logistics Investment BV and Griffin Real Estate on the acquisition of land for the construction of a warehouse in Zabrze, Poland.N/APolandHere
26-JunGesselGessel advised Polish stem cell bank Polski Bank Komorki Macierzystych on its EUR 420,000 acquisition of 53% of the share capital of Milan-based Sorgente S.r.l.EUR420000PolandHere
29-JunSSW Pragmatic SolutionsSSW Pragmatic Solutions helped Gaming Factory SA obtain approval for its prospectus from the Polish Financial Supervision Authority for a planned public offering and application for admission and introduction of shares to trading on the regulated market of the Warsaw Stock Exchange.N/APolandHere
30-JunHogan LovellsHogan Lovells advised Santander Leasing S.A. on legal and tax aspects of its synthetic securitization of a portfolio of lease receivables worth PLN 2 billion. As part of the transaction, the EIB Group will guarantee the mezzanine tranche in the amount of PLN 284 million and the senior tranche of PLN 1.7 billion.PLN2billionPoland
1-JulAllen & Overy; Gorrissen Federspiel; Wardynski & PartnersWardynski & Partners and Gorrissen Federspiel advised the Salling Group on the acquisition of shares in Tesco. Allen & Overy advised Tesco.N/APolandHere
1-JulBrockhuis Jurczak Prusak Sroka Nilsson; SSW Pragmatic SolutionsBSJP advised Germany's PNE on an acquisition of a Polish wind farm project with a total nominal wind capacity of 60 MW. SSW Pragmatic Solutions advised the seller.N/APoland
1-JulGreenberg TraurigGreenberg Traurig advised Panattoni Development Europe on a transaction related to the financing and planned development of a logistic park near Warsaw.EUR132millionPolandHere
1-JulCMS; DentonsCMS advised Bayerische Landesbank on financing to Pacifico Energy Partners for the construction of three wind farms with a total capacity of almost 52 MW. Dentons advised the borrower.PLN366millionPolandHere
1-JulBrockhuis Jurczak Prusak Sroka Nilsson; SchoenherrBSJP advised DB Schenker on a real estate acquisition and investment implementation related to the construction of a green cross-dock terminal in the Swidnik Business Activity Zone in Lubelskie Voivodeship, Poland. Schoenherr advised the contractor.EUR10millionPoland
3-JulRymarz ZdortRymarz Zdort represented Polskie Goornictwo Naftowe i Gazownictwo S.A. in arbitration proceedings against PAO Gazprom and OOO Gazprom Export involving PGNiG's demand that the contract price for gas supplied by Gazprom under an agreement commonly known as the Yamal Contract be revised.N/APolandHere
3-JulGreenberg TraurigGreenberg Traurig advised Panattoni Development Europe on the acquisition of an undeveloped plot in Gdansk from unidentified sellers.N/APolandHere
3-JulDentons; DLA PiperDLA Piper advised Grupa PZU on the lease of 47,000 square meters of office, retail, and warehouse space in the Generation Park Y in Warsaw from Skanska. Dentons advised Skanska on the deal.PLN787millionPolandHere
3-JulKochanski & PartnersKochanski & Partners helped Forteam Investments overcome the attempt by Polish entrepreneur Mariusz Switalski to have the District Court in Poznan lift an injunction against him and his assets in an ongoing proceeding.USD86millionPolandHere
7-JulGesselGessel advised the Polish Stem Cell Bank on the signing of a preliminary contract for the purchase of 100% of shares in Germany's Eticur from InGeneron and another owner.N/APolandHere
7-JulSSW Pragmatic SolutionsSSW Pragmatic Solutions advised Fitch Ratings on the multi-stage restructuring of the Fitch Group in Europe.N/APolandHere
8-JulDLA PiperDLA Piper advised Katoen Natie, an international logistics service provider and port operator, on the acquisition of the Polish warehousing activities of the Nijhof-Wassink logistics company. The sellers were advised by solo practitioner Boguslaw Kanski.N/APolandHere
8-JulMrowiec Fialek & PartnersMrowiec Fialek & Partners advised Mota-Engil Real Estate Management on its issuance of private corporate bonds.PLN15millionPolandHere
9-JulGreenberg TraurigGreenberg Traurig advised Lee Hecht Harrison on the acquisition of the enterprise of Development & Business Consulting Gniazdowski i Partnerzy sp.k., which had been operating as the Polish Lee Hecht Harrison representative.N/APolandHere
9-JulBaker Mckenzie; DLA PiperDLA Piper advised private equity investor Resource Partners on the sale of a majority stake in Golpasz to De Heus, an international animal feed manufacturer. Baker McKenzie advised De Heus on the deal.N/APolandHere
10-JulNorton Rose Fulbright; Rosicki, Grudzinski & Co.Norton Rose Fulbright advised Bank Polska Kasa Opieki S.A. on refinancing the debt of Polska Zegluga Morska Group companies in connection with the acquisition of five vessels. Rosicki, Grudzinski & Co. advised Polska Zegluga.N/APolandHere
13-JulClifford ChanceClifford Chance advised mBank S.A. on Echo Investment S.A.'s up-to-PLN 150 million bond issuance.PLN150millionPolandHere
14-JulSMM LegalSMM Legal advised the Energa Group on the acquisition of a wind farm project in Poland from Energa Invest.N/APolandHere
15-JulBalicki Czekanski Gryglewski Lewczuk; Grant Thornton; WKB Wiercinski Kwiecinski BaehrWKB advised Orbico and Distribev Orbico on the sale of 80% of shares in the share capital of Distribev Orbico to United Beverages. Grant Thornton advised United Beverages. BCGL advised Bank Pekao S.A. on its provision of financing for the acquisition.N/APolandHere
15-JulLinklatersLinklaters advised Chariot Top Group BV on the EUR 1 billion sale of a 1.8 hectare investment plot in Katowice, Poland, to unnamed buyers.EUR1billionPolandHere
15-JulNorton Rose FulbrightNorton Rose Fulbright advised the Accolade Group on its acquisition and development of a new multi-tenant logistics park in Gorzow Wielkopolski, Poland.EUR47millionPolandHere
15-JulGesselGessel advised Creepy Jar and Ipopema Securities shareholders on the sale of Creepy Jar shares in a public offering via an accelerated book-building procedure.PLN45millionPolandHere
22-JulNorton Rose FulbrightNorton Rose Fulbright advised a consortium of ten banks on a PLN 5.5 billion loan to Gaz-System, Poland's designated natural gas transmission system operator.PLN5.5billionPolandHere
24-JulKurzynski Kosinski Lyszyk Wierzbicki; Soltysinski Kawecki & SzlezakSoltysinski Kawecki Szlezak advised IKEA Industry Poland, a member of the IKEA Group, on the sale of its furniture factory in Konstantynow Lodzki to a member of Latvia's Vakaru Medienos Grupe. Kurzynski Kosinski Lyszyk Wierzbicki advised Vakaru Medienos on the deal.N/APolandHere
24-JulRymarz ZdortRymarz Zdort advised PGNiG S.A. on the execution of a five-year agreement with Klaipedos Nafta for the use of the entire capacity of its liquid natural gas tanker truck reloading station in Klaipeda, Lithuania.N/APolandHere
27-JulAllen & Overy; Clifford ChanceClifford Chance advised a consortium consisting of the EBRD, ING Bank Slaski, mBank, and Santander Bank Polska on financing of PLN 480 million to Polenergia for the construction of a 121 MW wind farm in Debsk, Poland. Allen & Overy advised Polenergia.PLN480millionPolandHere
27-JulCK Legal; Greenberg TraurigGreenberg Traurig advised UBS and Ipopema Securities on Ryvu Therapeutics' PLN 140 million new share offering. Chabasiewicz, Kowalska, and Partners advised Ryvu Therapeutics.PLN140millionPolandHere
28-JulCMSCMS advised Bonair on its sale to the Netherlands' Fellowmind group, which is owned by Sweden's FSN Capital private equity fund.N/APolandHere
28-JulGTS Legal; SSW Pragmatic SolutionsSSW Pragmatic Solutions advised Kom-Eko on its acquisition of 69.46% of shares in Lubelska Agencja Ochrony Srodowiska.N/APolandHere
28-JulNoerr; Rapala Law FirmNoerr advised Telekom Innovation, a strategic investment fund of Deutsche Telekom, on an unspecified equity investment in Poland's RemoteMyApp technology company. The Rapala Law Firm advised RemoteMyApp.N/APolandHere
28-JulSchoenherrSchoenherr advised Panattoni Europe on its lease of space at Poland's Panattoni Park Ruda Slaska II to Dywidag-Systems International sp. z o.o., a producer of geotechnical and compression systems.N/APolandHere
29-JulAllen & Overy; Brockhuis Jurczak Prusak Sroka Nilsson; Clifford Chance; Soltysinski Kawecki & SzlezakBSJP successfully represented Polish cement producer Dyckerhoff Polska in cartel proceedings pending since 2006. Allen & Overy, Clifford Chance, Wardynski & Partners, and SK&S Soltysinski Kawecki & Szlezak advised various plaintiffs.EUR100millionPoland
30-JulKochanski & PartnersKochanski & Partners successfully represented Ringier Axel Springer Polska in a dispute with the Polish Filmmakers Association that reached Poland's Supreme Court involving the calculation of royalties.N/APolandHere
30-JulDLA Piper; Hogan LovellsHogan Lovells advised arrangers and investors ING Bank NV and ING Bank Slaski S.A. on the securitization of the portfolio of receivables from leasing contracts of Santander Consumer Multirent. The issuer was advised by DLA Piper.PLN950millionPoland
31-JulKochanski & PartnersKochanski & Partners successfully represented Polish journalist Mikolaj Podolski in criminal proceedings.N/APolandHere
31-JulSSW Pragmatic SolutionsSSW Pragmatic Solutions advised Polish resin manufacturer LERG S.A. on the acquisition of CIECH Zywice, another Polish resin manufacturer.EUR36millionPolandHere
4-AugBCGL; SchoenherrSchoenherr advised shareholders of Dagat-Eco on sale of 100% of shares in Dagat-Eco sp. z o.o. to Omikron PE. BCGL advised Dagat-Eco.N/APoland
5-AugBaker Mckenzie; Clifford ChanceBaker McKenzie advised PKN Orlen on a revolving facility agreement under English law with a consortium of 16 banks. Clifford Chance advised the lenders on the deal.EUR1.75billionPolandHere
6-AugKPRF Law Office; LinklatersLinklaters advised Chariot Group, a company managed by Griffin Real Estate, on the extension of leases with Auchan Poland for six retail properties. The KPRF Law Office advised Auchan Poland.N/APolandHere
6-AugMatczuk, Wieczorek i Wspolnicy; SchoenherrSchoenherr advised the Polish subsidiary of the Assa Abloy Group on the acquisition of 100% of the shares in Donimet BIS sp. z o.o. Matczuk, Wieczorek i Wspolnicy advised Donimted BIS.N/APoland
7-AugBird & Bird; Norton Rose FulbrightBird & Bird advised Wento and Enterprise Investors on the EUR 50 million sale of Eco Power sp. z o.o. to PGE Energia Odnawialna. The Warsaw office of Norton Rose Fulbright advised the buyers on the deal.EUR50millionPolandHere
10-AugBaker MckenzieBaker McKenzie advised ElectroMobility Poland SA on agreements with Torino Design and EDAG Engineering Gmbh regarding the construction and assembly of electric cars in Poland.N/APolandHere
11-AugDecisive Worldwide Szmigiel Papros Gregorczyk.Decisive Worldwide Szmigiel Papros Gregorczyk advised the Skarbiec Dochodowych Nieruchomosci Fizan investment fund on the negotiation and sale of retail premises in Wroclaw's Old Town.N/APolandHere
17-AugDentons; DLA Piper; Greenberg TraurigGreenberg Traurig advised Panattoni Development Europe on the sale of the Lodz City VI logistics park to Kajima Properties and Savills Investment Management. DLA Piper advised Savills Investment Management and Dentons advised Kajima Properties.N/APolandHere
17-AugCMS; Freshfields; Wistrand; WKB Wiercinski Kwiecinski BaehrCMS and Sweden's Wistrand law firm advised Nordex SE on its execution of a put option agreement for the potential sale of Nordex's European wind and photovoltaic development pipeline to RWE. Freshfields Bruckhaus Deringer and WKB reportedly advised RWE on the transaction.EUR402.5millionPolandHere
21-AugDentons; Greenberg TraurigGreenberg Traurig advised the Metropol Group on the acquisition of regional shopping centers in the Polish cities of Gdynia, Olkusz, Radom, Swietochlowice, and Siemianowice from subsidiaries of the Atrium group. Dentons advised the Atrium Group on the deal.N/APolandHere
25-AugGesselGessel advised CD Projekt on the buy-back of its shares.PLN214millionPolandHere
27-AugB2Rlaw; Dagital Legal; Dentons; Ssw Pragmatic SolutionsSSW Pragmatic Solutions advised BoomBit on its sale of a part of its shareholding in SuperScale to British venture capital fund Level-Up. Dentons advised Level-Up on the deal while B2RLaw, working with London's Fieldfisher and Bratislava's Dagital Legal law firms, also advised BoomBit and its founder Ivan Trancik.N/APolandHere
28-AugEversheds Sutherland; Latham & WatkinsEversheds Sutherland advised Icos Capital on an unspecified Series B investment in Carbon Clean Solutions. Latham & Watkins advised Carbon Clean Solutions on the deal.N/APolandHere
31-AugB2RLawB2RLaw assisted USPTC with a consultancy project relating to the merger of Politechnika Bialostocka and the University of Bialystok.N/APolandHere
31-AugB2RLaw; DechertB2RLaw and Dechert advised Barings BDC, Inc. on its merger with MVC Capital, Inc.N/APolandHere
31-AugGreenberg TraurigGreenberg Traurig advised Ekstraklasa S.A. on the sale of media rights for the Polish premier football league to broadcast networks CANAL+ and TVP.PLN1billionPolandHere
2-SepWolf TheissWolf Theiss advised Concept Development BSD 2 on the sale of the 9000-square-meter 15-floor Concept Tower office building in Warsaw to the CPI Property Group.N/APolandHere
3-SepBird & Bird; Smolarek Rogala CabanBird & Bird advised mBank on a financing and refinancing deal with Nordic Solar Energy related to the construction of 26 solar farms in northwestern Poland. Smolarek Rogala Caban advised Nordic Solar Energy on the deal.N/APolandHere
3-SepDecisive Worldwide Szmigiel Papros GregorczykDecisive Szmigiel Papros Gregorczyk advised the Revetas Group on its lease of almost 2600 square meters of space in Warsaw's Trinity One office building to the local branch of an unidentified telecom holding company.N/APolandHere
3-SepGessel; Grabarek Szalc i WspolnicyGessel advised OEX on an investment in iPOS that will see OEX take up newly issued shares constituting the majority of iPOS' share capital. Grabarek Szalc i Wspolnicy reportedly advised iPOS on the deal.N/APolandHere
4-SepBaker Mckenzie; Greenberg TraurigGreenberg Traurig advised Oanda Global Corporation on the acquisition of Dom Maklerski TMS Brokers S.A from Nabbe Investments, a subsidiary of PineBridge Investments. Baker McKenzie advised Nabbe and PineBridge Investments on the deal.N/APolandHere
7-SepDentons; Greenberg TraurigGreenberg Traurig advised Invesco Real Estate on the sale of a logistics center in Lodz to Savills Investment Management, acting on behalf of Savills IM European Logistics Fund 2. Dentons advised the buyer on the deal.N/APolandHere
7-SepGrochowicz Law OfficeThe Grochowicz Law Office advised Stena Investment S.a.r.l. on the sale of its Polish subsidiaries Shaletech Energy sp. z o.o. and Northam sp. z o.o. in a management buyout.N/APolandHere
7-SepMrowiec Fialek & PartnersMrowiec Fialek and Partners advised Redan SA on the sale of shares in Top Secret sp. z o.o. to the company's majority shareholder.N/APolandHere
9-SepDentonsDentons advised MaForm Holding Luxembourg S.A R.L. on its tender offer to purchase 66% of shares in WSE-listed Fabryki Mebli Forte S.A.N/APolandHere
9-SepNautaDutilh; Wardynski & PartnersWardynski & Partners, working alongside NautaDutilh, advised Desch Holding B.V. on its acquisition of 100% of shares in Interplast Plastic Products sp. z o.o.N/APoland
9-SepBWHS Wojciechowski Springer i WspolnicyBWHS Wojciechowski Springer i Wspolnicy advised Uranpres, spol. s.r.o. on a EUR 70 million construction agreement with a consortium consisting of Mirbud S.A, Kobylarnia S.A, and Zrzeszenie Budowlane Interbudmontaz.EUR70millionPolandHere
9-SepCMSCMS advised Aareal Bank on the EUR 153 million refinancing of Accolade Group's industry parks portfolio, which includes locations in the Polish communities of Szczecin, Bydgoszcz, Lublin, Legnica, Bialystok, and Zielona Gora.EUR153millionPolandHere
10-SepDecisive Worldwide Szmigiel Papros GregorczykDecisive Szmigiel Papros Gregorczyk advised Nexity Polska on a general construction agreement with Wegner.N/APolandHere
10-SepCMS; Wolf TheissWolf Theiss advised the European Investment Bank on a EUR 10 million financing to Scope Fluidics S.A., a Polish medical technology company that designs diagnostic systems. CMS advised Scope Fluidics on the deal.EUR10millionPolandHere
17-SepClifford Chance; White & CaseWhite & Case advised Valmet on its acquisition of the PMP Group. Clifford Chance Warsaw advised the seller on the deal.EUR64millionPolandHere
18-SepDLA Piper; NoerrDLA Piper advised the founder of Top System, a flexible packaging company in the dairy industry in Poland, on the sale of an 80% stake to Switzerland's Aluflexpack. Noerr advised Aluflexpack on the deal.N/APolandHere
20-SepBartosz Kalupa; DLA Piper; Kondracki Celej; Wardynski & Partners; White & CaseDLA Piper and Batosz Kalupa assisted TDJ-Pitango Ventures Holding; Kondracki Celej assisted Manta Ray Ventures, RST Ventures for Earth, and Movens Venture Capital; and Wardynski & Partners assisted a private individual on their subscription to new shares in StethoMe sp. z o.o. White & Case advised the StethoMe.N/APoland
20-SepAabo-Evensen & Co; Schjodt; Wardynski & PartnersWardynski & Partners, working alongside Aabo-Evensen & Co, advised Danish IT group KMD -- part of the NEC Corporation -- on Polish aspects of the acquisition by its Banqsoft subsidiary of Norwegian software company Concent. Schjodt advised Banqsoft.N/APoland
21-SepDentons; Greenberg TraurigGreenberg Traurig advised Madison International Realty on its acquisition of an unspecified stake in Cavatina Office sp. z o.o., the owner of the Chmielna 89 office building in Warsaw, from Cavatina Holding S.A., as well as on its entry into a joint venture agreement with Cavatina Holding S.A. and the refinancing of the existing bank debt of Cavatina Office sp. z o.o. Dentons reportedly advised Cavatina Holding S.A. on the deal.N/APolandHere
22-SepJeantet; Jones Day; Nautadutih; Noerr; Wardynski & PartnersNoerr is advising the Schwarz Group on its intended takeover and potential entrance into a strategic partnership with the French Suez Group in the waste disposal and recycling business. Jones Day and Wardynski & Partners advised Suez on the deal. NautaDutilh in Luxembourg and the Netherlands and Jeantet in France worked on the deal as well.EUR1.1billionPolandHere
24-SepDentons; DLA PiperDLA Piper in Poland advised Elite Partners Capital on the acquisition of a warehouse in the Polish town of Mszczonow from P3 Logistic Parks. Dentons advised P3 Logistic Parks on the deal.N/APolandHere
25-SepDLA PiperDLA Piper helped Aerotunel obtain financing from Pekao bank for the construction of the Deepspot diving pool in the Polish town of Mszczonow, together with conference and hotel facilities. The BB law firm advised Pekao bank on the deal.N/APolandHere
28-SepClifford Chance; Gorzelnik Nentwig Ziebinski; SorainenClifford Chance advised Sun Investment Group Polska on the sale of a 170 megawatt solar parks portfolio currently under development to Ignitis Renewables. Gorzelnik Nentwig Ziebinski and Sorainen advised the buyer on the deal.N/APolandHere
28-SepBredin Prat; Soltysinski Kawecki & Szlezak; White & CaseWhite & Case advised Play Communications and its shareholders, Novator and Olympia, on the EUR 2.2 billion sale of all of its shares to French telecommunication provider Iliad SA. Bredin Prat and Soltysinski, Kawecki & Szlezak advised the buyer on the deal.EUR2.2billionPolandHere
30-SepGreenberg TraurigGreenberg Traurig helped OTB Ventures launch a dedicated investment vehicle to support Europe's space technologies - the OTB Space Program I - backed by the European Investment Fund and the European Commission through the InnovFin for Equity program.N/APolandHere
1-OctSMM LegalSMM Legal advised PKN Orlen S.A. on its tender offer to buy the remaining shares in Energa S.A.N/APolandHere
1-OctBrockhuis Jurczak Prusak Sroka Nilsson; SchoenherrBSJP advised DB Schenker on the real estate acquisition and investment implementation related to the construction of a green cross-dock terminal located at the Rzeszow-Dworzysko Science and Technology Park in Podkarpackie Voivodeship, Poland. Schoenherr advised the contractor.EUR11millionPoland
2-OctDentons; Gorzelnik Nentwig ZiebinskiGNZ Legal advised WPM Mosty on a successful financing and refinancing deal with mBank for the construction of a 10 megawatt portfolio of photovoltaic projects. Dentons advised mBank.N/APolandHere
5-OctBird & BirdBird & Bird helped Santander Bank Polska implement the Salesforce CRM cloud-based system in Poland.N/APolandHere
5-OctOzog Tomczykowski; Soltysinski Kawecki & SzlezakSoltysinski Kawecki & Szlezak advised Britain's Smart Pension Ltd on the takeover of an IT team from Smart Pension's contractor, Code & Pepper. The Ozog Tomczykowski law firm advised Code & Pepper.N/APolandHere
6-OctGrant Thornton; Studnicki, Pleszka, Cwiakalski, GorskiSPCG advised the Vafo Group on its acquisition of 100% of the shares in Carry Pet Food. Grant Thornton advised the seller on the deal.N/APolandHere
6-OctBenvalor; Eversheds Sutherland; Malecki Legal; Soltysinski Kawecki & SzlezakEversheds Sutherland advised Cogito Capital Partners on its EUR 3.7 million Series A investment in digital healthcare provider HomeDoctor. Malecki Legal, Soltysinski Kawecki & Szlezak, and the Netherlands' Benvalor law firm advised HomeDoctor and its founders on the deal.EUR3.7millionPolandHere
7-OctJDPJDP advised Free Now, the owner and operator of a ride sharing app, on compliance matters related to the new set of regulations in Poland applicable to the ride share market.N/APolandHere
8-OctJDPJDP advised Trei Real Estate GmbH on a EUR 51 million loan it received for its Polish subsidiaries from pbb Deutsche Pfandbriefbank.EUR51millionPolandHere
9-OctJDPJDP assisted the Greenpack Group with the establishment of a legal and tax presence in Poland.N/APolandHere
9-OctGesselGessel advised the founders of R2G Polska on the sale of a block of shares to a subsidiary of the Abris CEE Mid-Market III LP fund, managed by Abris Capital Partners Ltd.N/APolandHere
9-OctSMM LegalSMM Legal advised Miedzynarodowe Targi Poznanski on its sale of a 5.5 hectare plot in the center of Poznan, Poland.PLN114.5millionPolandHere
12-OctWKB Wiercinski Kwiecinski BaehrWiercinski, Kwiecinski, Baehr worked alongside lead counsel Osborne Clark in advising Giant Ventures on the Polish aspects of an unspecified investment in Airly sp. z o.o.N/APolandHere
12-OctWKB Wiercinski Kwiecinski BaehrWiercinski, Kwiecinski, Baehr advised Baltic Green I sp. z o.o. on contractor selection for the Katy Wind Farm project in Poland.N/APolandHere
12-OctKochanski & PartnersKochanski & Partners is representing Polish tennis player Katarzyna Kawa pro bono in her dispute against the International Tennis Federation and the French Tennis Federation.N/APolandHere
12-OctAct BSWWAct BSWW advised Pracuj Ventures on the acquisition of a minority stake in Gamfi.N/APolandHere
12-OctAllen & Overy; Clifford ChanceClifford Chance advised mBank on a PLN 150 million loan to Polenergia for the VAT and costs of construction of the Kostomloty wind farm in Poland. Allen & Overy advised Polenergia on the deal.PLN150millionPolandHere
13-OctAllen & Overy; Clifford Chance; Greenberg TraurigGreenberg Traurig and Allen & Overy advised the global coordinators, joint bookrunners, and lead managers on Allegro.eu's IPO and the admission of Allegro shares to listing on the Warsaw Stock Exchange. Clifford Chance advised Allegro on the IPO.PLN9.2billionPolandHere
15-OctStudnicki, Pleszka, Cwiakalski, GorskiSPCG represented a group of former shareholders of Merlin.pl S.A. in a dispute with Switalski & Synowie Sp. z o.o.N/APolandHere
15-OctDWF; Norton Rose FulbrightDWF advised Enertrag on the sale of the Dargikowo and Karlino windparks in Poland to Allianz Capital Partners. Norton Rose Fulbright advised Allianz Capital Partners on the deal.N/APolandHere
16-OctCrido Legal; DWFCrido Legal advised the Avenger Flight Group on its entry onto the Polish market and establishment of a joint venture with Enter Air. DWF Poland advised Enter Air.N/APolandHere
16-OctWardynski and Partners; Willkie Farr & GallagherWardynski and Partners, working alongside Willkie Farr & Gallagher, advised CapVest Partners on its acquisition of Greenland Seafood from Pacific Andes through a portfolio company called Eight Fifty Food Group Limited.N/APoland
16-OctClifford Chance; DentonsDentons Poland advised DNB Bank Polska on its PLN 155 million financing package for Wilko 5, a special purpose vehicle of the Helios Energy Investments Fund, for the construction of five wind farms in Poland's Wielkopolskie region. Clifford Chance advised the borrowers on the deal.PLN155millionPolandHere
16-OctEversheds Sutherland; White & CaseEversheds Sutherland Wierzbowski advised the EEC Magenta fund on its PLN 12 million investment in CashDirector, a financial platform supporting small and medium-sized enterprises in liquidity management. White & Case advised CashDirector on the deal.PLN12millionPolandHere
19-OctFreshfields; Wardynski & PartnersWardynski & Partners, working alongside Freshfields Bruckhaus Deringer, advised British digital sports media company DAZN Group on the divestment of a majority stake in its football news website Goal.com to Integrated Media Company, a platform backed by US-based investment firm TPG.N/APoland
19-OctDWF; Haynsworth Sinkler Boyd; Mayer Brown; Wolf TheissDWF, working with US lead counsel Haynsworth Sinkler Boyd, advised Sonoco Products Company on the USD 120 million sale of its Europe contract packaging business, Sonoco Poland-Packaging Services sp. z o.o., to Prairie Industries Holdings. Mayer Brown and Wolf Theiss advised Prairie Industries Holdings on the transaction.USD120milionPolandHere
21-OctGreenberg TraurigGreenberg Traurig advised Innova/5 on its sale of an unspecified stake in Pekaes to Geodis in Poland.N/APolandHere
22-OctEversheds SutherlandEversheds Sutherland Wierzbowski advised Ricoh on the acquisition of IT company SimplicITy.N/APolandHere
22-OctGesselGessel advised Benefit Systems on its issuance of Series A and B bonds valued at PLN 100 million and their admission to trading on the Warsaw Stock Exchange's Alternative Trading System platform, as well as the bookrunner on the issuance, the Polish branch of Haitong Bankas.PLN100millionPolandHere
22-OctGesselGessel advised Poland-based paraffin producer Polwax on the public offering of its shares with subscription rights and admission of shares to trading on the Warsaw Stock Exchange.PLN20MillionPolandHere
23-OctGreenberg Traurig; SSW Pragmatic SolutionsGreenberg Traurig advised the Innova/6 private equity fund on its acquisition of a majority stake in Poland-based software developer STX Next from Maciej Dziergwa and other unnameds shareholders. SSW Pragmatic Solutions advised the sellers on the deal.N/APolandHere
23-OctRymarz Zdort; White & CaseRymarz Zdort advised MCI.PrivateVentures and AMC Capital IV Albatros S.a r.l. on their sale of ATM S.A. to Global Compute Infrastructure LP, a platform supported by the Goldman Sachs Merchant Banking Division. White & Case advised Global Compute Infrastructure on the transaction.N/APolandHere
23-OctGreenberg Traurig; Plesner Advocatfirmet; Wardynski and PartnersWardynski and Partners, working alongside Plesner Advocatfirmet, advised Danish company Faerch A/S on its acquisition from Sirap Gema S.p.A. of its Polish subsidiary Inline Poland sp. z o.o. Greenberg Traurig advised the seller.N/APoland
23-OctDAHL; Gorrissen Federspiel; Wardynski and PartnersWardynski and Partners and Gorrissen Federspiel advised Danish company SDK A/S on its acquisition of the Polish subsidiaries -- Freja Transport & Logistics p. z o.o. and Transcargo sp. z o.o -- of Danish company Freja A/S. DAHL advised the seller.N/APoland
26-OctLatham & Watkins; Linklaters; Wardynski and PartnersWardynski and Partners and Latham & Watkins advised Canpack S.A. as a co-issuer with Eastern PA Land Investment Holding LLC on its successful issue of EUR 600 million aggregate principal amount senior notes at 2.375% due 2027 and USD 400 million aggregate principal amount senior notes at 3.125% due 2025 under the laws of the state of New York. Linklaters advised the bond purchasers.EUR600millionandUSD400millionPoland
27-OctB2RlawB2RLaw advised the Life Science Innovation Fund on an unspecified investment in telemedicine startup Aidlab.N/APolandHere
27-OctDecisive Worldwide Szmigiel Papros GregorczykDecisive Worldwide Szmigiel Papros Gregorczyk advised France's Nexity Group on an agreement to work on an unspecified development project with Erbud.N/APolandHere
27-OctGesselGessel advised the Polish high-tech company DataWalk on the public offering of its new issue of shares worth approximately PLN 65 million to qualified investors via a book-building process.PLN65millionPolandHere
28-OctRymarz ZdortRymarz Zdort advised shareholders Mariusz Cieply and Maciej Jarzebowski on the sale of their shares in LiveChat Software S.A. in an accelerated bookbuilding process.N/APolandHere
29-OctClifford Chance; CMSClifford Chance's Warsaw office advised a consortium of banks including Santander Bank Polska S.A., Bank Millennium S.A., and Bank Polska Kasa Opieki S.A. on financing for Gemini Polska. CMS advised Gemini Polska on the deal.N/APolandHere
29-OctB2Rlaw; Jakub KapicaB2RLaw advised KnowledgeHub on its EUR 1 million investment in Genomtec. Solo practitioner Jakub Kapica advised Genomtec on the deal.EUR1millionPolandHere
30-OctWiercinski Kwiecinski BaehrWiercinski, Kwiecinski, Baehr advised E&W, which belongs to Danish Eurowind Energy A/S and Windbud Sp. z o.o., on agreements to construct four wind farms in Poland.N/APolandHere
30-OctDLA Piper; Rymarz ZdortRymarz Zdort advised Nemera on the acquisition of Copernicus sp. z o.o. DLA Piper advised the unidentified sellers on the transaction.N/APolandHere
30-OctB2RlawB2RLaw advised Apis Venture on an unspecified investment in the Polish video game developer Byte Barrel.N/APolandHere
30-OctBrzozowska & Barwinska; DLA PiperDLA Piper advised Polish banks PKO BP and Santander on a PLN 113.5 million loan to Rockfin, an engineering company from the THC SICAV-RAIF portfolio. Brzozowska & Barwinska advised Rockfin and Tar Heel Capital Sp.z.o.o., the advisory company to the THC SICAV-RAIF fund, on the deal.PLN113.5millionPolandHere
2-NovBredin Prat; Clifford Chance; Herbert Smith Freehills; Soltysinski Kawecki & SzlezakClifford Chance and Herbert Smith Freehills advised Cellnex Telecom on its agreement with French telecommunication company Iliad SA to acquire a 60% stake in a new company that will operate Iliad-owned Play Communications' approximately 7,000 telecommunications sites in Poland. Soltysinski Kawecki & Szlezak and Bredin Prat advised Iliad.EUR800millionPolandHere
3-NovClifford Chance; Norton Rose FulbrightClifford Chance advised the Three Seas Initiative Investment Fund on its acquisition of Industrial Division from Abris Capital Partners. Norton Rose Fulbright advised the seller on the deal.N/APolandHere
3-NovDecisive Worldwide Szmigiel Papros GregorczykDecisive Szmigiel Papros Gregorczyk successfully represented Enel Invest, a member of the Enel-Med Group, in a lawsuit filed against its landlord.PLNĂŠ120000PolandHere
4-NovDentons; Greenberg TraurigGreenberg Traurig advised CA Immobilien Anlagen AG on the acquisition of P14 Sp. z o.o., the owner of the Postepu 14 office building in Warsaw, from HB Reavis. Dentons advised the sellers on the deal.N/APolandHere
4-NovKirkland & Ellis; SchoenherrSchoenherr and Kirkland & Ellis advised Summit Partners on its acquisition of a stake in product-information provider Syndigo.N/APoland
6-NovDLA Piper; LinklatersDLA Piper advised the PORR construction company on the sale of all its shares in Stal-Service to the Celsa Huta Ostrowiec steel plant in Poland. Linklaters advised Celsa Huta Ostrowiec.N/APolandHere
6-NovDomanski Zakrzewski PalinkaDomanski Zakrzewski Palinka and BIM Klaster, working with the European Commission, helped PwC develop a roadmap for the implementation of BIM methodology in public procurement together with templates of BIM documents for the Polish Ministry of Development.N/APolandHere
6-NovSSW Pragmatic Solutions; Vinge; Wardynski & PartnersWardynski & Partners and Vinge advised Granges AB on its acquisition of Aluminium Konin from the Boryszew Group. SSW Pragmatic Solutions advised the seller.EUR210millionPoland
6-NovBrockhuis Jurczak Prusak Sroka NilssonBSJP successfully represented DHV Polska, a subsidiary of the Netherlands-based DHV Royal Haskoning, which offers aviation, building, and architectural services, in a dispute with Poland's General Directorate for National Roads and Motorways (GDDKiA) that has been pending since 2011.EUR662000Poland
9-NovKwasnicki, Wrobel & PartnersRKKW advised Omikron Capital on its acquisition of ZAP-Mechanika from an unidentified seller.N/APolandHere
10-NovKrassowski Law Firm; Wiercinski Kwiecinski BaehrThe Krassowski Law Firm advised the Bielenda Kosmetyki Naturalne cosmetics company on its acquisition of the Dermika and Soraya brands and a production facility in Radzymin, Poland, from the Orkla Group. Wiercinski Kwiecinski Baehr advised the Orkla Group on the transaction.N/APolandHere
10-NovKrassowski Law Firm; LinklatersLinklaters advised the Lux Med Group on its acquisition of an unspecified stake in Lecznice Citomed. Krassowski advised the founders of Lecznice Citomed on the transaction.N/APolandHere
11-NovGreenberg TraurigGreenberg Traurig advised Panattoni Development Europe on its acquisition of an undeveloped plot of land near Nadarzyn, Poland.N/APolandHere
11-NovBaker MckenzieBaker McKenzie advised Troax on its acquisition of Natom Logistic, a Polish manufacturer of warehouse equipment. KPMG Law advised the seller, Natom Logistic founder Tomasz Swiatek, on the transaction.N/APolandHere
11-NovDecisive Worldwide Szmigiel Papros GregorczykDecisive Szmigiel Papros Gregorczyk advised Nexity Polska on its acquisition of a plot of land in Warsaw's Bemowo district from an unspecified seller.N/APolandHere
11-NovBaker Mckenzie; Dla PiperDLA Piper advised Mid Europa Partners on the acquisition of a majority stake in GWD Concept Displate from its founders, Credo Ventures, and Miton Capital. Baker McKenzie advised the sellers on the transaction.N/APolandHere
13-NovSSW Pragmatic SolutionsSSW Pragmatic Solutions advised Boryszew S.A. on the sale of Impexmetal S.A. to Sweden's Granges AB. The transaction was executed at Impexmetal's valuation of PLN 938 million.PLN938millionPolandHere
16-NovDecisive Worldwide Szmigiel Papros GregorczykDecisive Szmigiel Papros Gregorczyk helped Enel-Med extend its medical clinic lease agreement with the CPI Property Group until 2030.N/APolandHere
16-NovDomanski Zakrzewski Palinka; SDZLegal SchindhelmSDZLegal Schindhelm helped Max Streicher win a PLN 1 billion contract from Gaz-System to construct compressor stations in the Polish communities of Goleniow and Gustorzyn as a part of the Baltic Pipe project. Domanski Zakrzewski Palinka advised Gaz-System on the deal.PLN1billionPolandHere
18-NovDentonsDentons advised Stadler Polska on the conclusion of a framework agreement and execution of contracts worth PLN 600 million with Krakow's public transport company to provide 60 Lajkonik II trams.PLN600millionPolandHere
19-NovB2RLawB2RLaw helped WalkSee attract an investment from the EVIG Alfa venture capital fund.N/APolandHere
19-NovDPPA Legal; DWFDWF advised International Workplace Group plc on its lease of space in the Skanska Wave complex in Gdansk. DPPA Legal advised Skanska on the deal.N/APolandHere
20-NovDentons; Greenberg TraurigGreenberg Traurig advised Hines Pan-European Core Fund on the acquisition of a mezzanine warehouse facility in Wroclaw from GLL Real Estate Partners. Dentons advised GLL Real Estate Partners on the deal.N/APolandHere
20-NovDabrowski i Partnerzy; Wardynski and PartnersWardynski and Partners advised Zhermack SpA (part of the DentsplySirona group) on the sale of 100% shares in the share capital of Zhermapol sp. z o.o. in a management buyout. The buyers were advised by Dabrowski i Partnerzy.N/APoland
20-NovFreshfields; Noerr; Wardynski & PartnersNoerr's Warsaw office advised private equity firm Enterprise Investors and its portfolio company Nu-Med on the EUR 32.5 million refinancing of the indebtedness of the Nu-Med Grupa S.A. and six of its subsidiaries. The financing was provided by Kartesia, a private debt fund manager based in Luxembourg. Freshfields and Wardynski & Partners advised Kartesia.EUR32.5millionPoland
23-NovDentons; Rymarz ZdortDentons advised Aviva Investors on the sale of two warehouses in the Wroclaw Business Park to an unspecified construction company managed by Griffin Real Estate. Rymarz Zdort advised the buyer on the deal.N/APolandHere
23-NovKochanski & PartnersKochanski & Partners helped Idea Bank become the first Polish financial service sector entity to obtain ISO 27017 and ISO 27001 certifications, confirming that its cloud computing solutions meet the necessary international standards.N/APolandHere
23-NovBaker Mckenzie; GesselGessel advised the Haitong Bank as the issue organizer, dealer, calculation agent, and documentation agent on Polska Grupa Farmaceutyczna's PLN 150 million bond issue. Baker McKenzie advised the issuer on the deal.PLN150millionPolandHere
24-NovBaker Mckenzie; SheridansBaker McKenzie advised the Embracer Group on the acquisition of Polish game developer Flying Wild Hog from Supernova Capital. Sheridans advised the sellers on the deal.N/APolandHere
26-NovSSW Pragmatic SolutionsSSW Pragmatic Solutions helped Mo-BRUK get prospectus approval from the Polish Financial Supervision Authority.N/APolandHere
26-NovCMS; SSW Pragmatic SolutionsCMS advised British insurance intermediary PIB Group Limited on the acquisition of WDB, an independent insurance broker in Poland. SSW Pragmatic Solutions advised sellers Mariusz Muszynski, Mateusz Holly, and Piotr Kumiega on the deal.N/APolandHere
26-NovGrant Thornton; Jara Drapala & PartnersJara Drapala & Partners helped the 4PL Central Station Group establish a joint venture with an unidentified Polish company. Grant Thornton advised the Polish co-venturer on the deal.N/APolandHere
27-NovSSW Pragmatic SolutionsSSW Pragmatic Solutions advised Stelmet on the squeeze-out and withdrawal of its shares from the Warsaw Stock Exchange. Stelmet's majority shareholder, Stanislaw Bienkowski, purchased all of the shares previously owned by minority shareholders.N/APolandHere
30-NovDLA Piper; Greenberg TraurigGreenberg Traurig advised Abris CEE Mid-Market Fund III L.P., managed by Abris Capital Ltd., on the acquisition of the Scanmed S.A. healthcare provider from Life Healthcare Group Holdings Limited. DLA Piper advised Life Healthcare Group Holdings on the transaction.N/APolandHere
30-NovRymarz ZdortRymarz Zdort advised European Logistics Investment on the acquisition of land and the construction of a high-tech warehouse complex in Radom, Poland.N/APolandHere
1-DecNoerrNoerr advised Verlagsgruppe Passau on the sale of its Polish publishing activities to PKN Orlen.N/APoland
1-DecBrockhuis Jurczak Prusak Sroka Nilsson; Radzikowski, Szubielska I WspolnicyBSJP advised Silownie Wiatrowe Development, a Polish wind power developer, on a sale of RES-related assets located in Poland to Tauron Ekoenergia, a unit of Polish state-owned energy group Tauron Polska Energia. Radzikowski, Szubielska I Wspolnicy advised the buyer.N/APoland
2-DecAct (BSWW); Hogan LovellsAct BSWW advised investment funds managed by Pekao TFI S.A on the PLN 2.5 billion bonds issue program of Miejskie Przedsirbiorstwo Oczyszczania w m. st. Warszawie sp. z o.o., aimed at financing the modernization and extension of a municipal waste incineration plant and the construction of a waste segregation plant in Warsaw. The program was developed in cooperation with Bank Pekao S.A. and Pekao Investment Banking S.A., both of which were advised by Hogan Lovells.PLN2.5billionPolandHere
3-DecB2RLaw; Paul Hastings; Ropes & Gray; Soltysinski Kawecki & SzlezakB2RLaw, working alongside lead counsel Ropes & Gray, advised a consortium of banks, including Goldman Sachs International and Barclays, as global coordinators and joint bookrunners, and HSBC and NatWest Markets as joint bookrunners, on Boparan Holding Ltd.'s GBP 475 million high yield bond issue of five-year (non-call two) 7.75% secured notes. The new financing package also includes a new GBP 80 million revolving credit facility. SK&S and Paul Hastings advised Boparan.N/APolandHere
3-DecAllen & Overy; White & CaseWhite & Case advised joint bookrunner Erste Group Bank AG on the Tauron Polska Energia SA issue of Series A Bonds for a total nominal value of PLN 1 billion. Allen & Overy advised Tauron Polska Energia on the deal.PLN1billionPolandHere
3-DecTaylor WessingTaylor Wessing advised the MLP Group on the public offering of its EUR 15 million bonds and their placement on the alternative Catalyst market of the Warsaw Stock Exchange.EUR15millionPolandHere
3-DecChabasiewicz Kowalska & Partners; White & CaseChabasiewicz Kowalska & Partners advised PragmaGO on the sale of 100% of its shares to Polish Enterprise Fund VIII, managed by Enterprise Investors. White & Case advised the buyer on the deal.EUR11.9millionPolandHere
4-DecRymarz ZdortRymarz Zdort advised European Logistics Investment on the acquisition of the Wroclaw Business Park warehouse complex from Aviva Investors.N/APolandHere
4-DecDeloitte LegalDeloitte Legal advised New Energy Investments on a green bonds issuance with a total nominal value of up to PLN 500 million.PLN500millionPolandHere
7-DecB2RLawB2RLaw advised Skanska Residential Development on the acquisition of two properties in the Wlochy district of Warsaw from an unspecified seller.PLN80millionPolandHere
8-DecCMS; SDZLegal SchindhelmCMS advised Macquarie's Green Investment Group on the acquisition of an operational 25.3 MW onshore wind farm in the western Polish village of Jozwin from Vortex Energy Poland and Max Bogl International SE. SDZLegal Schindhelm advised the selling shareholders Max Boegl and VPL Projects.N/APolandHere
9-DecDomanski Zakrzewski Palinka; Jacek KosinskiDomanski, Zakrzewski, Palinka advised the Krakow Roads Authority on selecting a consortium of PPP Solutions Polska sp. z o.o. and Gulermak Agir Sanayi Insaat ve Taahhut a.s. as private contractor for the Krakow Fast Tram stage IV project, which involves the design, construction, and operation of the final stage of a new tram line. Jacek Kosinski advised the private partners on the deal.PLN1.25billionPolandHere
9-DecCMSCMS advised the BaltCap Infrastructure Fund on its entrance into a public-private partnership agreement for the construction of street lighting in the municipality of Kobylnica, in Poland.PLN12millionPolandHere
10-DecStudnicki, Pleszka, Cwiakalski, GorskiStudnicki, Pleszka, Cwiakalski, Gorski advised Enterprise Investors on the reorganization of Nu-Med Grupa S.A.N/APolandHere
11-DecMrowiec Fialek & Partners; Rymarz ZdortMrowiec Fialek and Partners advised Ferro S.A. on the acquisition of a majority stake in Termet S.A. and 100% of the shares of Tester sp. z o.o. Rymarz Zdort advised the seller.N/APolandHere
11-DecDLA Piper; Konieczny WierzbickiDLA Piper advised Polish Enterprise Fund VIII, managed by Enterprise Investors, on the acquisition of a majority stake in Polish software company Software Mind from Ailleron. Konieczny Wierzbicki advised Ailleron on the transaction.PLN111millionPolandHere
15-DecDentons; DWFDentons advised Heimstaden Bostad on its EUR 65 million acquisition of two build-to-rent projects in Warsaw's Praga-Polnoc and Sluzewiec districts from Eiffage Immobilier Polska. DWF advised the seller on the deal.EUR65millionPolandHere
15-DecARQIS; Brockhuis Jurczak Prusak Sroka Nilsson; SSW Pragmatic SolutionsBSJP and ARQIS advised Nethansa, a Polish startup offering Clipperon, an AI-driven sales and logistics automation software for the Amazon platform, on obtaining a late seed round funding in the amount of more than PLN 8 million from Movens VC, CofounderZone, and LT Capital investment funds. SSW Pragmatic Solutions advised investors Movens VC and CofounderZone.EUR1.76millionPoland
16-DecKancelaria Adwokacka Piotrowska Klak; Mrowiec Fialek & PartnersMrowiec Fialek and Partners advised Schindler Polska on the acquisition of 100% of the share capital of Wroclawskie Przedsiebiorstwo Remontowe Urzadzen Dzwigowych sp. z o.o. Kancelaria Adwokacka Piotrowska Klak advised the seller.N/APoland
17-DecAllen & Overy; White & CaseWhite & Case advised Mid Europa Partners on the acquisition of Sage Sp. z o.o. from The Sage Group plc, which was advised by Allen & Overy.N/APolandHere
18-DecLinklaters; Wolf TheissLinklaters advised Echo Investment on the acquisition of investment properties developed by Tesco in Poznan, Lodz, and Krakow, for the purposes of developing residential, office, commercial, and service facilities. Wolf Theiss advised Tesco on the transaction.EUR42millionPolandHere
21-DecGesselGessel successfully represented the Black Forest Fund in proceedings before Poland's Office of Competition and Consumer Protection involving its takeover of Corab.N/APolandHere
21-DecGesselGessel successfully represented the former president of Plus Bank in a criminal trial.N/APolandHere
22-DecLesnodorski Slusarek i WspolnicyLesnodorski, Slusarek i Wspolnicy, working pro bono, successfully represented journalist Polish Justyna Sliwowska-Mroz in her claims that an advertisement by Poland's Law and Justice party had violated her rights.N/APolandHere
22-DecSSW Pragmatic SolutionsSSW Pragmatic Solutions advised Mercator Medical on the accelerated book-building of its shares and their subsequent PLN 200 million sale by shareholders Anabaza and Urszula Zyznowska.PLN200millionPolandHere
23-DecGesselGessel advised the owner of MotionVFX on an unspecified investment in the Nextline search fund. Solo practitioner Jacek Klimczak advised Nextline on the deal.N/APolandHere
23-DecWKB Wiercinski Kwiecinski BaehrWiercinski, Kwiecinski, Baehr helped PineBridge Investments obtain clearance from the Polish competition authority for its acquisition of control over Benson Elliot Capital Management.N/APolandHere
23-DecTaylor WessingTaylor Wessing Warsaw advised MLP Group S.A., in connection with the public offering of series D ordinary bearer stocks and the introduction of rights to series D stocks to trade on the main market of the Warsaw Stock Exchange.N/APolandHere
23-DecMoskwa Jarmul Haladyj i Wspolnicy; Rymarz Zdort; SSW Pragmatic SolutionsRymarz Zdort advised Bank Pekao S.A. on the acquisition of a 38.33% stake in Krajowy Integrator Platnosci S.A. Moskwa, Jarmul, Haladyj i Wspolnici advised KIP on the deal, while SSW Pragmatic Solutions advised the majority shareholder of Krajowy Integrator Platnosci.N/APolandHere
23-DecGreenberg TraurigGreenberg Traurig advised PCF Group S.A. on its IPO and admission of the shares to trading on the Warsaw Stock Exchange.PLN203millionPolandHere
28-DecWKB Wiercinski Kwiecinski BaehrWiercinski, Kwiecinski, Baehr advised Nowe Jaworzno Grupa Tauron on the construction of a power unit with a nominal capacity of 910 MW in Jaworzno, Poland, following a mediation proceeding.N/APolandHere
28-DecGreenberg TraurigGreenberg Traurig advised HB Reavis Poland on a lease agreement with Leroy Merlin for office space at the Forest office campus in Warsaw.N/APolandHere
28-DecCMS; Sadkowski i WspolnicyCMS advised Bank Pekao S.A on the sale of Dom Inwestycyjny Xelion to Quercus TFI S.A. Sadkowski i Wspolnicy advised Quercus on the transaction.PLN38.5millionPolandHere
28-DecDomanski Zakrzewski PalinkaDomanski Zakrzewski Palinka advised the winning consortium of Aldesa Construcciones Polska sp. z o.o. and Aldesa Construcciones S.A. on a tender conducted by Poland's General Directorate for National Roads and Motorways for the design and building of the south Bialystok bypass on the Ksiezyno-Bialystok Poludnie section of Poland's S19 Expressway, together with the modernization of the DK 65 section.PLN456.14millionPolandHere
28-DecBrockhuis Jurczak Prusak Sroka NilssonBSJP successfully represented DHV Polska in a dispute with Poland's General Directorate for National Roads and Motorways.PLN2millionPolandHere
28-DecDomanski Zakrzewski PalinkaDomanski Zakrzewski Palinka helped Polskie Linie Lotnicze LOT S.A. obtain a positive European Commission decision approving state aid of PLN 2.9 billion. The EC found the aid aimed at mitigating the adverse effects of the COVID-19 pandemic compliant with EU rules.EUR2.9billionPolandHere
28-DecGunderson Dettmer; OrrickOrrick helped Brainly raise USD 80 million in Series D funding from a group of investors including Learn Capital, Prosus Ventures, Runa Capital, MantaRay, and General Catalyst. Gunderson Dettmer and B2RLaw advised Learn Capital on the deal.USD80millionPolandHere
29-DecGessel; Rymarz ZdortGessel advised the Black Forest Fund on an unspecified investment in ExploRNA. Rymarz Zdort advised ExploRNA on the deal.N/APolandHere
29-DecLinklatersLinklaters advised Austrian real estate asset and investment manager GalCap Europe on the acquisition of an office building in Warsaw from German investment fund UBS Real Estate GmbH.N/APolandHere
29-DecNoerr; SSW Pragmatic SolutionsNoerr assisted Brammer S.A., part of Rubix Group, with its acquisition of 100% ofĂŠ PEPE Sp. z o.o., which is active in the distribution of acid proof stainless steel components. SSW Legal advised the target.N/APoland
30-DecDentons; Konieczny WierzbickiDentons advised Nexity Polska on the sale of the La Praga residential project in Warsaw to Dutch fund Van der Vorm Vastgoed. Konieczny Wierzbicki advised the buyer on the deal.N/APolandHere
30-DecLinklatersLinklaters advised Resi4Rent on the acquisition of apartment buildings in Warsaw, Lodz, and Wroclaw from Echo Investment.N/APolandHere
30-DecStudnicki, Pleszka, Cwiakalski, GorskiStudnicki, Pleszka, Cwiakalski, Gorski successfully represented Tesco Polska in a dispute regarding the existence of a legal title to a property in a Warsaw shopping and service center.N/APolandHere
30-DecGessel; NoerrNoerr's Warsaw office advised German laboratory testing service provider GBA Gesellschaft fur Bioanalytik on the acquisition of JARS S.A., a Polish company operating a chain of laboratories focusing on environmental analysis, foodstuffs, consumer goods, and pharmaceutical analysis. The target was advised by Gessel.N/APoland
30-DecStudnicki, Pleszka, Cwiakalski, GorskiStudnicki, Pleszka, Cwiakalski, Gorski successfully represented the minority shareholders of PGE Elektrownia Opole in a PLN 260 million dispute with PGE Gornictwo i Energetyka Konwencjonalna and PGE Polska Grupa Energetyczna before the Court of Appeal in Warsaw involving compensation for an improper determination of the share exchange parity in the process of merging the companies.PLN260millionPolandHere
30-DecB2Rlaw; Gessel; Mrowiec Fialek & PartnersMrowiec Fialek and Partners advised Custodia Capital on the acquisition of 100% of the share capital of Atende Software sp. z o.o. B2Rlaw advised the sellers. Gessel advised the remaining investors.EUR11.6milionPoland
30-DecFreshfields; King & Spalding; Latham & Watkins; SchoenherrSchoenherr and Latham & Watkins advised AGRO Merchants Group on its sale to Americold Realty Trust. The buyers were advised by King & Spalding and Freshfields.EUR1.48billionPoland
31-DecCrido Legal; DWFDWF advised the Corum XL investment fund on the acquisition of the Astris office building in Krakow. Crido advised the seller.N/APoland
1-JanCMS; DentonsCMS advised Panattoni, Marvipol, Bluehouse, and Kajima on their sale of a portfolio of logistics parks including Panattoni Park Poznan IV, Panattoni Park Szczecin II, Panattoni Park Warsaw North, Panattoni Park Warsaw South, and Panattoni Park Ruda Slaska I, to a fund represented by Savills Investment Management LLP. Savills was advised by Dentons.N/APoland
20-SepAllen & Overy; CMSCMS advised BGK on a revolving loan of up to up to PLN 500 million granted to Energa S.A. Energa was advised by Allen & Overy.PLN500millionPoland
16-DecCMS; DentonsCMS advised AFI Properties on the acquisition and financing of an office building located at 12 Marynarska street in Warsaw from Starwood Capital Group. Dentons advised the seller.EUR100millionPoland
25-AugJadek & Pensa; Prica & Partners; Rymarz ZdortRymarz Zdort, Jadek & Pensa, and Prica & Partners advised Innova Capital on the sale of 100% of the shares of subsidiary Trimo d.o.o. to Kingspan Group plc.N/APoland; Serbia; SloveniaHere
12-OctKochanski & Partners; Squire Patton BoggsKochanski & Partners and Squire Patton Boggs both claimed success in their representation of Poland's Muszynianka Spolka z Ograniczona Odpowiedzialnoscia and the Republic of Slovakia, respectively, in international arbitration initiated under the Agreement on the Protection and Promotion of Investments between the Slovak Republic and the Republic of Poland.EUR170millionPoland; SlovakiaHere
26-MarBaker Mckenzie (Esin Attorney Partnership); Caliskan Okkan Toker; GesselGessel and Caliskan Okkan Tokker advised Polski Bank Komorek Macierzystych on its acquisition of 70% shares in the newly-created Famicord-Acibadem company. The Esin Attorney Partnership advised Acibadem on the transaction.N/APoland; TurkeyHere
10-JanAllen & Overy; CMSCMS advised Bank Gospodarstwa Krajowego and KUKE S.A. on an export credit financing granted by BGK and insured by KUKE in relation to the development of the Nikolsky shopping mall in Kharkiv. Allen & Overy advised the borrower.EUR53millionPoland; Ukraine
20-JanCMSCMS advised Bank Pekao S.A. and KUKE S.A. on an export credit financing granted by Bank Pekao S.A. and insured by KUKE S.A. in relation to the development of a solar photovoltaic plant in Ukraine.N/APoland; Ukraine
8-JanPeli Partners; Stratulat AlbulescuStratulat Albulescu advised Romanian health & fitness chain World Class Romania on its lease of a 1500 square meter space in Bucharest's Expo Business Park for a new fitness club. The lessor was advised by Peli Partners.N/ARomaniaHere
8-JanBulboaca & AsociatiiBulboaca si Asociatii advised D Moonshots, an investment fund created by Sacha Dragic, the founder of the Superbet group, on its investment in tech start-up Medicai.EUR500000RomaniaHere
15-JanGlodeanu & AssociatesGlodeanu & Partners negotiated a lease agreement for Amrest with Romanian railway company Caile Ferate Romane to open a new Starbucks in Bucharest's Gara the Nord train station.N/ARomaniaHere
23-JanPopovici Nitu Stoica & Asociatii; PwC Legal (D&B David si Baias)Popovici Nitu Stoica & Asociatii advised Swedish investment fund Oresa on the sale of its RTC Proffice Experience subsidiary, a stationery and office supplies company. D&B David si Baias advised the buyer, technology & communication producer and wholesaler Complet Electro Serv, which is part of the Altex group.N/ARomaniaHere
24-JanStratulat AlbulescuStratulat Albulescu advised Hagag on its acquisition of a 7013-square meter office building in Bucharest from NCH Capital.N/ARomaniaHere
28-JanStratulat AlbulescuStratulat Albulescu advised Bourbon Black Sea on its lease of 800 square meters of space in the Pipera Business Tower in Bucharest.N/ARomaniaHere
28-JanMitel & Partners; Stratulat AlbulescuStratulat Albulescu advised Bog'Art Residential on the acquisition of a 749 square meter land plot in Bucharest from an unnamed group of Spanish investors. Mitel & Partners advised the sellers.N/ARomaniaHere
29-JanBondoc & AsociatiiBondoc & Asociatii assisted McGuire Woods on the transformation and sale of its Romanian entity.N/ARomaniaHere
1-FebAllen & Overy; RTPR; Wolf TheissWolf Theiss assisted VISMA AS with the acquisition of a 50.1% stake in Romania'sĂŠ Intelligent IT. RTPR and Allen & Overy advised the seller.N/ARomania
1-FebCMS; Wolf TheissWolf Theiss advised OTP Bank Nyrt. And OTP Bank Romania S.A. on the EUR 27.4 million and RON 9,559,600 facilities granted to Cordia Parcului Residential Project. CMS advised the borrower.EUR27.4millionRomania
6-FebAct (Botezatu Estrade Partners); Gide Loyrette Nouel; Leroy si AsociatiiAct | Botezatu Estrade Partners assisted Teva Pharmaceuticals on the accession by its Romanian subsidiary to the group's securitization programme, arranged by BNP Paribas, Dublin Branch. Leroy si Asociatii and Gide Loyrette Nouel advised BNP Paribas.N/ARomaniaHere
11-FebCleary Gottlieb Steen & Hamilton; Clifford Chance; Filip & CompanyFilip & Company advised RCS & RDS and Digi Communications N.V. on issuing two series of senior secured bonds. Clifford Chance Badea and Cleary Gottlieb Steen & Hamilton advised lead arrangers Citibank, ING Bank N.V., and UniCredit Bank S.A.EUR850millionRomaniaHere
12-FebBPV Grigorescu StefanicaBPV Grigorescu Stefanica advised Iveco Defense Vehicles, part of the CNH Industrial group of companies, on its sale of over 2900 high mobility trucks to the Romanian Ministry of National Defense for a total value of over EUR 700 million.EUR700millionRomaniaHere
13-FebStratulat AlbulescuStratulat Albulescu advised Glory Global Solutions Ltd on Romanian law matters related to its investment in the Acrelec Group.N/ARomaniaHere
13-FebClifford Chance; Filip & CompanyClifford Chance Badea advised a consortium of BNP Paribas, Citigroup Global Markets Limited, Raiffeisen Bank International AG, Societe Generale, and Unicredit Bank AG on the sovereign bond issuance by the Romanian Ministry of Finance on external markets. The Ministry of Finance was advised by Filip & Co.EUR3billionRomaniaHere
13-FebStratulat AlbulescuStratulat Albulescu advised Beez on its receipt of EUR 1.2 million funding from GapMinder Venture Partners and ROCA X.EUR1.2millionRomaniaHere
13-FebDeloitte Legal (Reff & Associates)Reff & Associates successfully represented a consortium of construction companies led by the Spanish firm Viales Y Obras Publicas SA Cuenca in an international commercial arbitration regarding the construction of road infrastructure based on a FIDIC contract.EUR5millionRomaniaHere
15-FebPopovici Nitu Stoica & AsociatiiPNSA advised Senia Music on a public procurement tender organized by Gheorghe Dima Music Academy in Cluj-Napoca for the acquisition of several pianos.N/ARomania
17-FebBulboaca & Asociatii; Clifford ChanceClifford Chance Badea advised a syndicate of investment banks on the EUR 260 million high yield bonds issue of Frigoglass Finance B.V. Bulboaca & Asociatii advised Frigoglass.EUR260millionRomania
21-FebPopovici Nitu Stoica & AsociatiiPopovici Nitu Stoica & Asociatii assisted the AkzoNobel group on its inter-group merger of the company's Romanian subsidiary with the Fabryo Corporation.N/ARomaniaHere
24-FebWolf TheissWolf Theiss advised GlaxoSmithKline on Romanian aspects of a USD 9.8 billion joint venture agreement concluded with Pfizer, in order to create a new consumer health business.N/ARomania
28-FebKinstellar; RTPR Allen & OveryThe Bucharest office of Kinstellar advised Highlander Partners on its acquisition of Sano Vita. RTPR Allen & Overy advised the sellers.N/ARomaniaHere
28-FebRTPRRTPR advised Wyelands Capital, part of the Liberty Steel Group, on the acquisition of Romania's Banca Romana the Credite si Investitii from the Umbrarescu family. Solo practitioner Ana Maria Nistor advised the seller.N/ARomania
29-FebCEE AttorneysCEE Attorneys/Boanta, Gidei si Asociatii advised Olympian Parks Group on a new joint venture between Olympian Park Group entities and a new Lebanese investor for the development and management of existing and new real estate projects to be raised by the JV business partners.N/ARomania
1-MarDeloitte Romania; Tuca Zbarcea & AsociatiiTuca Zbarcea & Asociatii advised Vodafone Romania on completing its absorption pf UPC Romania, as part of a take-over by Vodafone Group Plc of Liberty Global's operations in various countries, including Romania. Reff & Associates advised UPC Romania.N/ARomania
1-MarEversheds Sutherland; Filip & Company; Wolf TheissFilip & Company assisted Alexander Barbut, Thomas Barbut, and Marcel Barbut on their sale of shares held in Adeplast S.A. to Switzerland's Sika AG group. Wolf Theiss advised Adeplast and Eversheds Sutherland advised Sika.N/ARomania
1-MarWolf TheissWolf Theiss advised Banca Comerciala Romana on the refinancing of the Hotel Cismigiu, which opened in 1912.EUR7.2millionRomania
5-MarBPV Grigorescu StefanicaBPV Grigorescu Stefanica successfully represented the Municipality of Bucharest in a dispute with two private companies involving the failure by its General Council to approve a Zonal Urban Plan.EUR5millionRomaniaHere
5-MarWhite & CaseWhite & Case persuaded UK's Supreme Court to accept the petition of Romanian entrepreneur Ioan Micula and the companies in which he invested, enabling an action to enforce a 2013 ICSID arbitral award of approximately EUR 300 million, plus interest.EUR300millionRomaniaHere
9-MarWillkie Farr & Gallagher; Wolf TheissWolf Theiss and Willkie Farr & Gallagher advised CIP Capital on the acquisition of shares in the U.S.-based company 3Pillar Global, Inc., including the indirect acquisition of its Romanian subsidiary.N/ARomania
11-MarKinstellarKinstellar advised First Farms on the acquisition of agricultural land from NCH Capital in Romania.N/ARomaniaHere
11-MarLeaua Damcali Deaconu PaunescuLeaua Damcali Deaconu Paunescu and LALIVE successfully represented the interests of Romania before ICSID, which on March 5 rejected claims against Romania amounting to over RON 9 billion brought by Ioan and Viorel Micula.RON9billionRomaniaHere
15-MarCEE AttorneysCEE Attorneys/Boanta, Gidei si Asociatii assisted the EMSA group with the exit of a former manager of its Aplast Wood Industry subsidiary.EUR1.6millionRomania
19-MarMusat & AsociatiiMusat & Asociatii advised the EBRD on a EUR 16 million facility granted to the TeraPlast Group.EUR16millionRomaniaHere
20-MarPopovici Nitu Stoica & AsociatiiPopovici Nitu Stoica & Asociatii advised S&T on the acquisition of an integrated IT system for the issuance of civil status documents as part of an EU co-financed project).EUR10millionRomania
23-MarArcliffeArcliffe advised Italian energy company Alerion on the acquisition of a 100 MW wind energy project in Romania from unnamed Romanian sellers.N/ARomaniaHere
1-AprLaura Vladuca Law Office; Tuca Zbarcea & AsociatiiTuca Zbarcea & Asociatii advised Holde Agri Invest on its acquisition of Agromixt Buciumeni. The Laura Vladuca Law Office advised the seller.N/ARomania
1-AprBondoc & Asociatii; CMS; DechertBondoc si Asociatii, working alongside Dechert, advised Profi on the drafting and negotiation of addenda to the existing security agreement and relevant financing ancillary documentation for the grant of an additional facility by a group of new lenders.ĂŠCMS advised the banksN/ARomania
1-AprMorgan Lewis & Bockius; Wolf TheissWolf Theiss heped Morgan, Lewis & Bockius provide advice on Romanian legislation to the Advanz Pharma Corp in regards to its prospective purchase of a Alprostadil pharmaceutical product portfolio from UCB Pharma Gmbh.N/ARomania
3-AprLeaua Damcali Deaconu PaunescuLeaua, Damcali, Deaconu, Paunescu successfully represented Trammo GmbH in a case involving the question of whether, in the firm's words, "temporary seizure of assets can preclude an enforcement procedure conducted by another creditor."N/ARomaniaHere
3-AprDobre Tulei si Asociatii; SchoenherrSchoenherr advised Bucur SA on its entrance into a partnership with Romanian real estate developer Novum Business Invest. Dobre Tuley si Asociatii advised Novum Business Invest.N/ARomania
5-AprPopovici Nitu Stoica & AsociatiiPopovici Nitu Stoica & Asociatii advised Deutsche Leasing Romania on the full implementation of the 4th AML Directive.N/ARomania
14-AprDeloitte Legal (Reff & Associates); Nestor Nestor Diculescu Kingston PetersenReff & Associates advised Forum Serdika, a Dutch financial holding group owned by British investment fund East Balkan Properties, on its sale of the Equest Logistic industrial park to CTP Bucharest. NNDKP advised the buyers on the deal..EUR30millionRomaniaHere
16-AprBPV Grigorescu StefanicaBPV Grigorescu Stefanica successfully represented Mondialacqua SRL in a dispute over a utility model for a public water fountain technically similar to a Mondialacqua product.N/ARomaniaHere
1-MayBondoc & Asociatii; Kinstellar; Latham & Watkins; White &ĂŠ CaseBondoc si Asociatii and White & Case advised agent and security agent Commerzbank Finance on financing provided to the buyer for its acquisition of All4Labels Global Packaging Group. Latham & Watkins was lead counsel to the borrower with Kinstellar advising on Romanian matters.N/ARomania
1-MayIulia Malis Law Office; Tuca Zbarcea & AsociatiiTuca Zbarcea & Asociatii advised a syndicate of Banca Comerciala Romana, BRD Groupe Societe Generale, Raiffeisen Bank, and Banca Transilvania on its extension of a credit facility amounting to EUR 90 million that had been granted to MedLife, along with an additional EUR 20 million. The Iulia Malis Law Office advised MedLife.EUR20millionRomania
4-MayPopovici Nitu Stoica & AsociatiiPopovici Nitu Stoica & Asociatii advised the Romanian branch of BLOM Bank France on a EUR 5 million loan to Isaran, a real estate developer from Brasov, to finance the development of residential projects.EUR5millionRomaniaHere
5-MayPopovici Nitu Stoica & AsociatiiPopovici Nitu Stoica & Asociatii advised Libra Internet Bank on its establishment of a partnership with Monesse.N/ARomaniaHere
7-MayFurtuna si AsociatiiFurtuna si Asociatii represented the Romanian Airport Services handling company before the Romanian Competition Council regarding the abuse of dominant position investigation of the Avram Iancu Cluj International Airport.N/ARomaniaHere
12-MayNoerrNoerr has advised the Bauer Media Group on the sale of its Romanian publishing business to Ringier.N/ARomaniaHere
18-MayFilip & CompanyFilip & Company assisted Raiffeisen Bank on the May 14, 2020, listing of lei-denominated subordinated bonds on the Bucharest Stock Exchange.RON480millionRomaniaHere
22-MayStratulat AlbulescuStratulat Albulescu successfully represented Hervis Sports & Fashion before a Specialized Tribunal in Cluj, winning an injunction for the deferred payment of part of the rent relating to the Vivo Shopping Center Cluj.N/ARomaniaHere
22-MayDeloitte Legal (Reff & Associates); DLA PiperReff & Associates advised the NH Hotel Group S.A. on Romanian aspects of a transaction which entailed two term loan facilities granted to it by undisclosed Spanish credit institutions. DLA Piper advised the lenders.EUR225millionRomania
26-MayBuzescu CaBuzescu Ca successfully represented Alvogen IPCO S.a.r.l., and Alvogen Romania S.R.L. before the Bucharest Court of Appeals in their challenge to an application by Teva Pharmaceutical Industries Ltd. for a preliminary injunction against the sale of a drug Alvogen distributes.N/ARomaniaHere
27-MayFilip & CompanyFilip & Company successfully represented Romania's Financial Supervisory Authority in a dispute against a former board member of the National Securities Commission involving labor and administrative issues worth over RON 1 million.RON1millionRomaniaHere
29-MayPopovici Nitu Stoica & AsociatiiPopovici Nitu Stoica & Asociatii advised Dedeman on the development and forward purchase of The Bridge 2 project, and on the development and forward purchase of The Bridge 3.N/ARomania
1-JunNoerrNoerr advised on Bristol-Myers Squibb on its corporate restructuring and setting up of a new operational company and business restructuring related to the recent acquisition by BMS of Celgene.N/ARomania
1-JunDeloitte Legal (Reff & Associates); Wolf TheissWolf Theiss assisted Ikea group member Ingka Investments on the staggered acquisition of 100% of the shares in seven portfolio companies in Romania, holding 171MW in nine wind farms. Reff & Associates advised the sellerN/ARomania
1-JunOliver Grimsley; Wilson Sonsini Goodrich & Rosati; Wolf TheissWolf Theiss and Wilson Sonsini Goodrich & Rosati assisted MHC Software LLC in the acquisition of Romanian Ecrion Software International SRL. Oliver Grimsley advised the seller.N/ARomania
1-JunFilip & Company; LinklatersFilip & Company, working alongside Linklaters, advised the Romanian Ministry of Public Finance on the issuance of Eurobonds in two tranches that raised EUR 3.3 billion from international markets.EUR3.3billionRomaniaHere
1-JunTuca Zbarcea & AsociatiiTuca Zbarcea & Asociatii successfully defended Astra Vagoane Calatori in a dispute with the Bucharest Municipality regarding a public procurement procedure for the acquisition of 110 trams.EUR176millionRomania
18-JunTuca Zbarcea & AsociatiiTuca Zbarcea & Asocatii successfully represented the Romanian Tennis Federation, led by former world tennis star Ion Tiriac, against several challenges to the registration of the new board.N/ARomaniaHere
22-JunBPV Grigorescu Stefanica; CEE AttorneysCEE Attorneys Boanta, Gidei si Asociatii advised the Sparking Capital investment fund on financing granted to the Romanian start-up K Factory. BPV Grigorescu Stefanica advised K-Factory on the deal.N/ARomaniaHere
23-JunKinstellarKinstellar advised FirstFarms, a Denmark-based land and agriculture investor in Eastern Europe, on the sale of a farm covering approximately 1,700 hectares in Western Romania.EUR11.4millionRomaniaHere
23-JunDLA Piper; Stratulat AlbulescuStratulat Albulescu advised CODA Intelligence on a EUR 800,000 seed funding round led by Romanian Early Game Ventures and including technology investment fund ROCA X and other angel investors. DLA Piper advised Early Game Ventures on the deal.EUR800000RomaniaHere
29-JunDLA PiperDLA Piper advised Early Game Ventures on financing provided to Humans DNA, a Romanian startup developing the technology for generating synthetic media. ROCA X and other angel investors also participated in the EUR 330,000 financing round.EUR330000RomaniaHere
30-JunCazacu, Manolache, PopaCazacu, Manolache, Popa advised a Romanian subsidiary of Raiffeisen Leasing on the sale of a large plot of land in Aleea Viilor in Timisoara, Romania.N/ARomaniaHere
3-JulPopovici Nitu Stoica & AsociatiiPopovici Nitu Stoica & Asociatii advised Warehouses De Pauw Romania on EUR 150 million facilities granted to it by the Bank for European Reconstruction and Development for financing the development of sustainable certified green logistic centers in Romania.EUR150millionRomania
8-JulRadulescu & Musoi; SchoenherrRadulescu & Musoi advised Black Sea Fund I on its acquisition of an unspecified stake in interior design and custom furniture company Intermedio General, which operates under the Theta brand. Schoenherr advised the seller.N/ARomaniaHere
9-JulCEE Attorneys; Digital 2 LawCEE Attorneys Boanta, Gidei si Asociatii advised the Sparking Capital investment fund on the financing of Romanian start-up Questo. Digital 2 Law advised Questo on the deal.N/ARomaniaHere
13-JulEY Law (Radu Si Asociatii)Acting on behalf of Chep Equipment Pooling NV, the tax litigation practice of Radu si Asociatii obtained a ruling from the Court of Justice of the European Union on the right of non-resident taxpayers to obtain VAT refunds.N/ARomaniaHere
15-JulCEE AttorneysCEE Attorneys/Boanta, Gidei si Asociatii advised the Romanian subsidiary of the EMSA group, Bravo Europa, on an intra-group corporate restructuring project, consisting of the transfer of 100% ownership of the German and Czech subsidiaries of Bravo Europa.EUR2.18millionRomania
16-JulStratulat AlbulescuStratulat Albulescu advised digital technology consulting company Brillio on the acquisition of Cognetik.N/ARomaniaHere
16-JulZamfirescu Racoti Vasile & PartnersZamfirescu Racoti Vasile & Partners successfully represented Banca Transilvania in a contract dispute before the Court of Justice of the European Union.N/ARomaniaHere
30-JulClifford Chance; Jankovic Popovic Mitic; SchoenherrClifford Chance Badea advised the Kingspan Group, a company specialized in high-performance insulation and building envelope solutions, on the acquisition of TeraSteel SA, TeraSteel DOO Serbia, and Wetterbest SA. Schoenherr advised TeraPlast on the deal.EUR85millionRomaniaHere
1-AugCEE Attorneys; DLA PiperCEE Attorneys/Boanta, Gidei si Asociatii advised the Sparking Capital Venture Fund on a seed investment contract with Bright Spaces. DLA Piper advised Bright Spaces.N/ARomania
1-AugCEE Attorneys; Hamed Roman & Ion AndreeaCEE Attorneys/Boanta, Gidei si Asociatii advised Sparking Capital Venture Fund on a seed investment contract with EcoTree. Hamed Roman & Ion Andreea advised EcoTree.N/ARomania
1-AugCEE AttorneysCEE Attorneys/Boanta, Gidei si Asociatii assisted Vertical Seven Group (Romanian venture capital fund focused on start-ups) in executing a seed investment agreement with EasySales.N/ARomania
1-AugCEE AttorneysCEE Attorneys advised Moonlet on the launch of its cryptocurrency wallet, designed to store various types of crypto-assets.N/ARomania
1-AugCEE AttorneysCEE Attorneys advised the FBCPA Crypto software platform on structuring its SaaS platform to ensure compliance with applicable regulatory requirements.N/ARomania
1-AugCEE AttorneysCEE Attorneys/Boanta, Gidei si Asociatii advised Smartit Global, which operates the EasySales Platform, on the launch of DealWise.N/ARomania
4-AugFilip & CompanyFilip & Company advised SoftwareONE Holding AG, a global provider of end-to-end software and cloud technology solutions, on the acquisition of B-lay, a provider of Software Asset Management advisory and managed services for SAP and Oracle solutions. Norton Rose Fulbright advised on Dutch and English Law.N/ARomaniaHere
10-AugPopovici Nitu Stoica & AsociatiiPopovici Nitu Stoica & Asociatii successfully represented the interests of the Association of Romanian Construction Companies and several other large construction companies before the Bucharest Court of Appeal.N/ARomaniaHere
11-AugZamfirescu Racoti Vasile & PartnersZamfirescu Racoti Vasile & Partners successfully represented Intermed Consulting & Management before the High Court of Cassation and Justice of Romania in a case involving industrial park real estate tax exemption.RON28millionRomaniaHere
17-AugBPV Grigorescu StefanicaBPV Grigorescu Stefanica advised Romanian start-up Innoship on its acquisition of EUR 550,000 in seed funding from GapMinder VC.EUR550000RomaniaHere
19-AugStratulat AlbulescuStratulat Albulescu successfully represented Romanian facility management company Compania Romprest Service S.A. in a dispute with the Ministry of European Funds in the Bucharest Court of Appeal.N/ARomaniaHere
24-AugWolf TheissAdivising the European Fund For Southeast Europe S.A.,SICAV-SIFi on financing granted to Garanti BBVA Leasing to expand financing opportunities for micro and small enterprises in Romania.EUR7millionRomania
31-AugPopovici Nitu Stoica & AsociatiiPopovici, Nitu, Stoica & Asociatii advised Belgian developer VGP Parks on the acquisition of 40 hectares of real estate in the Western Romanian city of Arad from an unnamed seller.N/ARomaniaHere
31-AugCEE AttorneysCEE Attorneys/Boanta, Gidei si Asociatii advised start-up Ringhel on a round of seed financing through the crowdfunding platform SeedBlink.EUR650.000Romania
31-AugCEE AttorneysCEE Attorneys/Boanta, Gidei si Asociatii assisted food retailer Cora Romania during the company's share capital decrease (reduction of the client's share capital against accounting losses) of EUR 5.1 million, as part of net equity redressing process.EUR6.5millionRomania
1-SepBiris Goran; NoerrNoerr advised Doosan Heavy Industries & Construction on the acquisition byĂŠ Romanian investment fund SIF Banat-Crisana of a 99.92% stake in the Doosan IMGB industrial platform. Biris Goran advised the buyer.N/ARomania
1-SepCEE AttorneysCEE Attorneys/Boanta, Gidei si Asociatii advised entrepreneur Andrei Cretu on his launch of the Pluria.co B2B platform, which offers access to an extended network of workspaces for company employees.N/ARomania
4-SepDeloitte Legal (Reff & Associates)Reff & Associates advised Romania's Haier Tech on a refrigeration factory construction project in Prahova county, Romania.N/ARomaniaHere
4-SepPopovici Nitu Stoica & AsociatiiPopovici Nitu Stoica & Asociatii advised Auchan in merger control proceedings before the Competition Council related to My Auchan proximity stores operating in Petrom gas stations.N/ARomania
4-SepCMS; Deloitte Legal (Reff & Associates); Herbert Smith Freehills; Wolf TheissCMS advised AFI Europe on its share acquisition of six companies owning four Class A office projects in Romania from NEPI Rockcastle. Herbert Smith Freehills and Reff & Associates - the Romanian member firm of Deloitte Legal - advised the seller. Wolf theiss advised the financing banks.EUR300millionRomaniaHere
7-SepKinstellar; PeliPartnersKinstellar advised a joint venture of Resolution Property and Zeus Capital Management on its acquisition of the Floreasca Park office complex in Bucharest from GLL Real Estate Partners. PeliPartners advised GLL Real Estate Partners.N/ARomaniaHere
9-SepDeloitte Legal (Reff & Associates); Leroy si AsociatiiLeroy and Associates advised Groupe Rocher on its acquisition of Romania's Sabon cosmetics and toiletries retailer, and with subsequent merger control procedures before the Romanian Competition Council. Reff & Asociatii advised the seller.N/ARomaniaHere
9-SepDentonsDentons advised TC Capital on its EUR 20 million acquisition of a grain and oilseed farm from France's Gespie SAS.EUR20millionRomaniaHere
10-SepNestor Nestor Diculescu Kingston PetersenNNDKP advised shareholders Gheorghe Iana and Vlad Ardeleanu on the sale of a majority stake in Medima Health to Morphosis Capital. Schoenherr's Bucharest office reportedly advised Morphosis Capital on the deal.N/ARomaniaHere
14-SepPopovici Nitu Stoica & Asociatii; SchoenherrPopovici Nitu Stoica and Asociatii advised Auchan Retail Romania on its agreement with OMV Petrom to place 400 MyAuchan stores in the Petrom network of filling stations over the next five years.N/ARomaniaHere
15-SepNestor Nestor Diculescu Kingston Petersen; Popovici Nitu Stoica & Asociatii; Schwartz & AsociatiiPopovici Nitu Stoica & Asociatii advised WDP, a Belgian developer and owner of logistics centers and warehousing, on the acquisition of the Aquila Logistics Centre in Cluj from _SNS Logistic Investment, the Craiova Logistics Centre in Dolj from Tamo-Ko Development SRL, and the Dunca Logistics Centre in Timis from Dunca Imobiliare. NNDKP advised SNS Logistic investment and Schwartz & Asociatii advised Tamo-Ko Development on those two deals.N/ARomaniaHere
17-SepGlodeanu & AssociatesGlodeanu & Partners advised Blue Rock Investments on the acquisition of two logistic centers in Bucharest from unspecified sellers.N/ARomaniaHere
22-SepCEE AttorneysCEE Attorneys / Boanta, Gidei si Asociatii advised Romanian entrepreneur Andrei Cretu on the launch of the Pluria B2B platform.N/ARomaniaHere
22-SepPopovici Nitu Stoica & AsociatiiPNSA advised Burda Group on the sale of its business in Romania to an unspecified buyer.N/ARomaniaHere
24-SepBondoc & AsociatiiBondoc & Asociatii advised Eviva Energy on the restructuring of an outstanding commercial debt owed to it by an unspecified renewable energy operator in Romania.N/ARomaniaHere
25-SepFilip & CompanyActing on behalf of Hidroelectrica, Filip & Co successfully persuaded the European Court of Justice to, in the firm's words, "confirm the free market status for all energy transactions by stating that imposing OPCOM as the sole transaction platform for producers is an unjustified restriction on the free movement of goods."N/ARomaniaHere
28-SepTuca Zbarcea & AsociatiiTuca Zbarcea & Asociatii advised the Clever Business Transilvania media group on its acquisition of Prima TV in Romania.N/ARomaniaHere
30-SepNestor Nestor Diculescu Kingston Petersen; Wolf TheissWolf Theiss advised Artis Bio Tech SRL on the transfer of part of its business to a global manufacturer of dental implants. NNDKP advised the buyer.N/ARomania
1-OctSuciu PopaSuciu Popa successfully represented Grup Feroviar Roman in its request that a bankruptcy claim filed against its subsidiary Rovit SA be dismissed.N/ARomaniaHere
2-OctMPR Partners | Maravela, Popescu & AsociatiiMPR Partners advised Interparking on its acquisition of the Bucur Obor Parking building in Bucharest from Parcaj Subteran Bucur Obor.N/ARomaniaHere
5-OctNoerr; Stratulat Albulescu; Taylor WessingNoerr advised Michael Jaffe, the insolvency administrator of Wirecard Sales International Holding GmbH, on the sale of all shares of its subsidiary Wirecard Romania SA to SIBS. Stratulat Albulescu and Taylor Wessing advised SIBS on the deal.N/ARomaniaHere
6-OctPopovici Nitu Stoica & AsociatiiPNSA advised Bico Industries and majority shareholder Mihai Birliba on the acquisition of a 30% stake in Bico by Roca Investments.N/ARomaniaHere
6-OctBPV Grigorescu StefanicaBPV Grigorescu Stefanica advised the Hornbach Group on the development of a DIY mega-store in Oradea, Romania.N/ARomaniaHere
6-OctFilip & Company; Nestor Nestor Diculescu Kingston Petersen; Popovici Nitu Stoica & AsociatiiFilip & Co advised BCR on its sale of equal 33.3% stakes in the CIT One armored car company to BRD Groupe Societe Generale and Raiffeisen Bank Romania. PNSA advised BRD Groupe Societe Generale on the deal, while NNDKP advised Raiffeisen Bank Romania.N/ARomaniaHere
7-OctStratulat AlbulescuStratulat Albulescu advised Bog'Art Residential on the acquisition of two land plots in Bucharest from OMV Petrom S.A.N/ARomaniaHere
9-OctDigital 2 Law; Stratulat AlbulescuStratulat Albulescu advised GapMinder Venture Partners on an unspecified investment in Cartloop, an eCommerce conversational marketing platform start-up. Digital 2 Law advised Cartloop.EUR300000RomaniaHere
15-OctTuca Zbarcea & AsociatiiTuca Zbarcea & Asociatii helped founders Florin Maxim, Eugen Zbircea, and Daniel Nanboe launch Comarket, a B2B marketplace for the Romanian hospitality industry.N/ARomaniaHere
16-OctMusat & Asociatii; NNDKPNNDKP advised Romanian entrepreneur Daniel Boaje on the sale of his 10% stake in Premier Capital SRL and Premier Assets SRL to the Premier Capital Group. Musat & Asociatii advised the buyer on the deal.N/ARomaniaHere
16-OctBPV Grigorescu StefanicaBPV Grigorescu Stefanica helped Forty Management obtain a license from U.S.-based Crystal Lagoons to develop the EUR 100 million Central District Lagoon City in Bucharest.N/ARomaniaHere
21-OctBondoc & AsociatiiBondoc & Asociatii advised Adient on the Romanian aspects of its global sale of its automotive fabrics manufacturing business, including its lamination business, to Sage Automotive Interiors.USD175millionRomaniaHere
27-OctGo2Law; Mills & Reeve; RTPR; Vernon David & AssociatesRTPR and Go2Law advised Innova Capital on its acquisition of PayPoint Services and Payzone from the PayPoint Group. Vernon David & Associates, working in cooperation with the UK's Mills & Reeve law firm, advised PayPoint on the deal.N/ARomaniaHere
28-OctStratulat AlbulescuStratulat Albulescu advised GapMinder Venture Partners and DayOne Capital on their joint investment in Romanian startup Soleadify.N/ARomaniaHere
30-OctDLA Piper; Orrick; Wilson Sonsini Goodrich & RosatiOrrick advised GapMinder on its participation in the EUR 3 million Series Seed financing of Romanian start-up Deepstas. DLA Piper advised Deepstash and Wilson Sonsini Goodrich & Rosati advised Connect Ventures, another investor.EUR3millionRomania
14-NovPopovici Nitu Stoica & AsociatiiPopovici Nitu Stoica & Asociatii advised the Estoria Group on the development and sale of a big-box retail facility, including a commercial gallery, to Leroy Merlin, Kaufland, and Lidl, in a series of transactions.EUR20millionRomania
17-NovD'Ornano Partners; Dechert; Eversheds Sutherland; Freshfields; Norton Rose Fulbright; Popovici Nitu Stoica & Asociatii; Tuca Zbarcea & AsociatiiD'Ornano Partners, PNSA, and Norton Rose Fulbright advised the Orange Group on its EUR 268 million acquisition of a 54% stake in Telekom Romania from the OTE Group. Dechert and Eversheds Sutherland advised the OTE Group and Tuca Zbarcea & Asociatii advised Telekom Romania.EUR268millionRomaniaHere
18-NovAllen & Overy; RTPR; Skils; Tuca Zbarcea & AsociatiiRadu Taracila Padurari Retevoescu and Allen & Overy advised Macquarie Infrastructure and Real Assets on its acquisition of the CEZ Group's Romanian assets. Skils and Tuca Zbarcea & Asociatii advised CEZ.N/ARomaniaHere
18-NovRTPRRadu Taracila Padurari Retevoescu advised Mitiska REIM on its subsidiary's sale of property in Romania.N/ARomaniaHere
25-NovKinstellar; Nestor Nestor Diculescu Kingston PetersenNNDKP advised CTP on the acquisition of the A1 Bucharest Park from Cromwell Property, acting as the Central European Industrial Fund's intermediary. Kinstellar advised the seller on the deal.N/ARomaniaHere
26-NovBPV Grigorescu Stefanica; PeliPartnersBPV Grigorescu Stefanica advised Supernova on its acquisition of the Jupiter City Shopping Mall in Pitesti, Romania, from Mall Retail Rom. PeliPartners advised the seller on the deal.N/ARomaniaHere
26-NovAllen & Overy; RTPR; Simmons & Simmons; Zamfirescu Racoti Vasile & PartnersRTPR and Allen & Overy advised EximBank as the coordinating mandated lead arranger and a syndicate of Banca Comerciala Intesa Sanpaolo Romania, Banca Transilvania, CEC Bank, Garanti Bank, ING Bank's Bucharest Branch, International Bank for Economic Co-operation, OTP Bank Romania, Raiffeisen Bank Romania, and UniCredit Bank on the refinancing and maturity extension of a USD 150 million revolving facility granted to Romanian aluminum producer Alro. Zamfirescu Racoti Vasile & Partners and Simmons & Simmons advised the borrower on the deal.EUR150millionRomaniaHere
1-DecJinga & Asociatii; Tuca Zbarcea & AsociatiiTuca Zbarcea & Asociatii advised Engie Romania on its purchase of a photovoltaic park with an installed capacity of 9.3 MW from Ever Solar SA, a subsidiary of German photovoltaic park developer Soventix and developer Alpin Solar. Jinga & Asociatii advised Ever Solar.N/ARomania
1-DecNoerrNoerr advised Messer Romania Gaz on its acquisition of 34% of the shareholding in Messer Energo Gaz SRL from Energomontaj SA and of 66% of the shareholding in Messer Energo Gaz SRL from Messer Group GmbH.N/ARomania
1-DecBondoc & Asociatii; The Law ChamberBondoc si Asociatii assisted UCB Romania with the negotiation of a long-term lease agreement with One United Properties.ĂŠThe Law Chamber advised the owner.N/ARomania
1-DecCEE AttorneysCEE Attorneys/Boanta, Gidei si Asociatii advised Olympian Parks Group on the acquisition of 60,000 square meter property for the purpose of extending the development of the Olympian Est Bucharest logistics and industrial park.N/ARomania
1-DecSchoenherr; Tuca Zbarcea & AsociatiiTuca Zbarcea & Asociatii advised coordinator, mandated lead arranger, documentation agent, facility and security agent Banca Comerciala Romana, along with mandated lead arrangers ING Bank N.V. Amsterdam, Bucharest Branch, Raiffeisen Bank SA, and OTP Bank Romania SA, on a EUR 51 million syndicated loan to Pehart, which is owned by Abris Capital Partners. Schoenherr advised Pehart/Abris Capital Partners.EUR51millionRomania
1-DecDLA Piper; Tuca Zbarcea & AsociatiiTuca Zbarcea & Asociatii advised entrepreneurs Bogdan Buta and Sveatoslav Veaceslav Vizitiu on the launch of an application called Extasy, including on an initial investment by the founders of EUR 500,000 and a subsequent pre-seed investment of EUR 350,000 from Early Game Ventures and entrepreneur Voicu Oprean. DLA Piper advised Early Game Ventures.EUR850000Romania
3-DecD&B David and Baias; RTPR; Wolf TheissRTPR and D&B David si Baias advised shareholders Doina and Roxana Cepalis on the sale of Te-Rox Prod to Sweden's Holmbergs group. The Bucharest office of Wolf Theiss advised the buyer on the deal.N/ARomaniaHere
4-DecNestor Nestor Diculescu Kingston Petersen; Stratula & AsociatiiNestor Nestor Diculescu Kingston Petersen advised a syndicate consisting of Banca Comerciala Romana as the bookrunner, mandated lead arranger, documentation agent, and facility and security agent, CEC Bank as mandated lead arranger, and participating banks EximBank, Intesa Sanpaolo Romania, and OTP Bank Romania on an EUR 90 million loan facility to the Carmistin Group. Stratula & Asociatii advised the borrower on the deal.EUR90millionRomaniaHere
9-DecOrrick; Stratulat AlbulescuStratulat Albulescu, working alongside Orrick Herrington & Sutcliffe, advised GapMinder Venture Partners on a follow-on investment in Romanian start-up Deepstash.N/ARomaniaHere
14-DecHogan Lovells; SchoenherrSchoenherr advised Allianz-Tiriac on the acquisition of Gothaer Asigurari Reasigurari from the Gothaer Group. Hogan Lovells advised the Gothaer Group on the transaction.N/ARomaniaHere
14-DecPeliPartners; RTPRRTPR advised the OLX Group on its acquisition of Kiwi Finance from Oresa Ventures. PeliPartners advised the seller on the deal.N/ARomaniaHere
15-DecMusliu & Asociatii; Nestor Nestor Diculescu Kingston PetersenNestor Nestor Diculescu Kingston Petersen advised Opel Groupe PSA on the sale of its Romanian business to Trust Motors, an independent importer for the Peugeot, Citroen, and DS brands. Trust Motors was advised by Musliu & Asociatii.N/ARomaniaHere
15-DecHategan Attorneys; RTPRRTPR advised 123FormBuilder and its shareholders Catalyst Romania, Florin Cornianu, and Adrian Gheara on attracting an investment from the 212 venture capital fund. Hategan Attorneys advised 212 on the deal.N/ARomaniaHere
15-DecKinstellar; Pop Attorneys At LawKinstellar advised the Black Sea Fund I on the acquisition of Romanian dental imaging network DigiRay. Cluj-based Pop Attorneys at Law advised the seller on the deal.N/ARomaniaHere
16-DecKinstellar; Peli PartnersKinstellar advised S Immo AG on the acquisition of Campus Buildings 6.2 & 6.3 - two class A office buildings in Bucharest - from Skanska. Peli Partners advised Skanska on the deal.EUR97millionRomaniaHere
17-DecKinstellar; LC LegalproofKinstellar advised Romania's Mirus Group on the acquisition of Romania's Nexia CRG from shareholders Luminita Ristea, Silvia Elena Ichimescu, and Marioara Zaifu. LC Legalproof advised the sellers on the deal.N/ARomaniaHere
18-DecBird & Bird; Stratulat AlbulescuStratulat Albulescu, working alongside lead counsel Bird & Bird, advised Motion Equity Partners on its investment in Educastream.N/ARomaniaHere
22-DecIjdelea MihailescuIjdelea Mihailescu and software company Ringhel Team were contracted by the Romanian Energy Regulatory Authority to prepare a study on an energy supplier switch.N/ARomaniaHere
23-DecSuciu PopaSuciu Popa successfully assisted Gianni Versace S.r.l., the owner of the Versace trademarks, with a series of judiciary and extra-judiciary procedures involving the defense of Versace's trademarks against an unauthorized producer and distributor based in the European Union.N/ARomaniaHere
23-DecAllen & Overy; Filip & Company; KinstellarFilip & Company helped RCS & RDS S.A. and the companies in its group, Digi Communications N.V., DIGI Tavkozlesi (RCS & RDS' Hungarian branch), Invitel Tavkozlesi Zrt, and DIGI Spain Telecom S.L.U. (RCS & RDS's Spanish branch) obtain two medium-term credit facilities worth a total of EUR 150 million and an incremental facility structure from a syndicate of Citigroup Europe plc - Dublin Romanian Branch, ING Bank N.V. Amsterdam Bucharest Branch, and Unicredit Bank S.A. Kinstellar and Allen & Overy advised the lenders.EUR150millionRomaniaHere
29-DecBondoc & Asociatii; CMSCMS advised Hidroelectrica, the Romanian majority state-owned hydropower producer, on the acquisition of an operational 108 MW wind farm located in the Constanta county of Romania from Germany's STEAG group. Bondoc & Asociatii advised STEAG on the deal.N/ARomaniaHere
29-DecFilip & Company; LinklatersFilip & Company, working with Linklaters, advised the Ministry of Public Finance of Romania in a two-tranche Eurobond issue that drew over EUR 2.5 billion from the international markets.EUR2.5billionRomaniaHere
29-DecCMSCMS advised the National Bank of Greece on the disposal of a Romanian-risk corporate non-performing and sub-performing loan portfolio to a consortium composed of Bain Capital Credit and APS.EUR174millionRomaniaHere
19-NovD&B David And Baias; Karanovic & Partners; Maravela, Popescu & AsociatiiMPR Partners helped J. Christof E&P Services S.R.L. and Christof Private Firefighting Services S.R.L. provide notification to Romanian and Serbian competition authorities of the economic concentration arising from OMV Petrom's externalization of several operations and general surface services ancillary to extraction and production of petroleum as well as natural gas, together with the relevant assets and dedicated staff. D&B David and Baias and Karanovic & Partners provided advice to J. Christof E&P and Christof Private Firefighting Services.N/ARomania; SerbiaHere
8-JanRustam Kurmaev & PartnersRustam Kurmaev & Partners successfully represented Boris Dubrovskiy, the former governor of Russia's Chelyabinsk region, in a dispute with the Antimonopoly Service of Russia.N/ARussiaHere
17-JanEgorov Puginsky Afanasiev & PartnersEgorov Puginsky Afanasiev & Partners helped BlaBlaCar to obtain clearance from Russia's competition authority for its purchase of Busfor, an online bus ticker aggregator.N/ARussiaHere
30-JanAlrud; OrrikAlrud, working alongside Orrick, advised the Soprema Group on its acquisition of 100% of both JSC Myagkaya Krovlya and JSC ET-Plast, which produce roofing and sound insulation products in Samara.N/ARussia
12-FebLiniya PravaLiniya Prava is an official partner to Russia's "Great Heart" charity fund.N/ARussiaHere
25-FebBryan Cave Leighton PaisnerBryan Cave Leighton Paisner advised Enisey THC, a subsidiary of the Siberian Generating Company, on its RUB 10 billion acquisition of Krasnoyarsk GRES-2 from OGK-2.RUB10billionRussiaHere
27-FebEgorov Puginsky Afanasiev & PartnersEgorov, Puginsky, Afanasiev and Partners advised the Uralsoloto Group of Companies on its acquisition of securities of Petropavlovsk PLC.N/ARussiaHere
27-FebWhite & CaseWhite & Case advised VTB Capital as auction organizer and financial advisor to UTLC on its RUB 60.3 billion auction of a controlling stake in Russian railway container operator TransContainer.USD968millionRussiaHere
28-FebDebevoiseDebevoise & Plimpton advised Norilsk Nickel on the upsizing and extension of its December 2017 syndicated facility agreement.USD1.65billionRussiaHere
1-MarAlrudAlrud advised Kernel Holding S.A. on the sale of a 50% stake in Taman Grain Terminal Holdings Limited.N/ARussia
12-MarMacfarlanes; Rybalkin, Gortsunyan & PartnersRybalkin, Gortsunyan & Partners and Macfarlanes advised AEON Corporation on its sale of a 28.34% stake in Petropavlovsk Plc to the Yuzhuralzoloto Group.N/ARussiaHere
18-MarAlrud; Integrites; Norton Rose FulbrightIntegrites and Switzerland's HFW law firm advised MUFG Bank and a syndicate of lending banks including Citi, Credit Agricole, and Societe Generale on a limited recourse term loan to finance Trafigura's acquisition of copper cathodes from the Swiss trading arm of the Russian mining group Norilsk Nickel. Trafigura was advised by Norton Rose Fulbright and Alrud.N/ARussiaHere
19-MarBryan Cave Leighton Paisner; LinklatersLinklaters advised Sovcombank as arranger on the RUB 5.7 billion domestic green project bonds issued by an orphan special purpose vehicle, SFO RuSol 1 LLC, for the purpose of financing two of Solar Systems LLC's solar stations in the Astrakhan region of Russia. Bryan Cave Leighton Paisner advised the issuer.RUB5.7billionRussiaHere
26-MarStetomStetom advised Skoda Transportation on its entrance into a joint venture with Sinara-Transport Machines. The joint venture company, Sinara-Skoda, will be based in St. Petersburg, and will produce trams, trolleybuses and subway kits for the Russian market.N/ARussiaHere
2-AprAlrud; Clifford Chance; WilmerHaleThe Moscow office of Clifford Chance formed part of a multi-jurisdictional team helping GE obtain US and global merger clearance in connection with the USD 21.4 billion sale of its BioPharma business to Danaher, advised by WilmerHale and Alrud.N/ARussiaHere
8-AprBryan Cave Leighton PaisnerBryan Cave Leighton Paisner advised PJSC RusHydro on that sale of a 90% shareholding in JSC International Energy Corporation to OJSC Hrazdan Power Company. As part of the transaction, OJSC refinanced MEK's debt obligations to the EBRD and the Asian Development Bank.N/ARussiaHere
8-AprKachkin & PartnersKachkin & Partners successfully defended the interests of the Mamoshin Architectural Workshop in a dispute over the creation of a new stage at the Maly Drama Theater in St. Petersburg.RUB22.4millionRussiaHere
22-AprBaker MckenzieLawyers in Baker McKenzie's Moscow office were part of the firm's multi-jurisdictional team advising arrangers and dealers Citi and J.P. Morgan and dealers Barclays, BofA Securities, and HSBC on the establishment of a USD 6.5 billion Global Medium Term Note program by VEON.USD6.5billionRussiaHere
28-AprBaker Mckenzie; DLA PiperDLA Piper advised Russian private equity firm Baring Vostok on the acquisition of a minority stake in Synergetic, a Russian manufacturer of environmentally friendly detergents and cosmetics. Synergetic was advised by Baker McKenzie.N/ARussiaHere
30-AprWhite & CaseWhite & Case advised VTB Bank on the USD 1.7 billion restructuring of Russian mining and metal company Mechel PAO and on various matters connected to the related sale of the Elga Coal Complex, one of Mechel's main assets.USD1.7billionRussiaHere
4-MayDLA PiperDLA Piper advised Debex on the sale of a minority stake in the company to Dmitry Shushkin, the managing director of ABBYY Russia.N/ARussiaHere
8-MayAlrud; Kirkland & Ellis; Slaughter and May; Weil, Gotshal & MangesAlrud, working alongside Weil, Gotshal & Manges and Slaughter and May, advised Allergan plc. on the sale of shares to AbbVie. Kirkland & Ellis advised AbbVie.USD63billionRussia
11-MayAlrud; Monastyrsky, Zyuba, Stepanov & PartnersAlrud advised the Mechel Group on the sale of its 51% participatory interest in the companies which operate the Elga coalfield project in Russia to A-Property. Monastyrsky, Zyuba, Stepanov & Partners advised A-Property on the deal, which was valued at RUB 89 billion.RUB89billionRussiaHere
14-MayBryan Cave Leighton Paisner; TA Legal ConsultingBryan Cave Leighton Paisner advised PJSC Sovcombank and Mobile Payments LLC on their entrance into a partnership with IDRAM LLC and IDBank CJSC, which were advised by TA Legal Consulting.N/ARussiaHere
15-MayAlrud; Gibson, Dunn & CrutcherAlrud and Gibson, Dunn & Crutcher advised Triton Partners on its acquisition of Lamina Technologies SA, a Swiss manufacturer of carbide cutting tools.N/ARussia
18-MayAkin Gump; Clifford ChanceAkin Gump advised PJSC Lukoil on its issuance of USD 1.5 billion Eurobonds listed on the Main Market of the London Stock Exchange. Clifford Chance advised joint lead managers Citigroup, Societe Generale CIB, and Bank GPB International S.A. (Gazprombank).USD1.5billionRussiaHere
25-MayDebevoise & PlimptonDebevoise & Plimpton is advising PAO TMK, a producer of tubular products for the oil and gas industry, on the repurchase of its regular shares by subsidiary Volzhsky Pipe Plant JSC, and on the prospective delisting of TMK's global depositary receipts from the London Stock Exchange.USD300millionRussiaHere
28-MayVegas LexVegas Lex won what it calls "two crushing victories" in the Arbitration Court of the North-Western District for pharmaceutical company Alium in disputes related to a contract for the construction of a large pharmaceutical plant.N/ARussiaHere
28-MayLiniya PravaLiniya Prava helped the VTB Group attract investors to Demeter Holding.N/ARussiaHere
1-JunWhite & CaseWhite & Case advised Alliance Oil Company Ltd. on a tender offer and consent solicitation in respect of its USD 500 million 7.000% Guaranteed Notes due 2020.USD500millionRussiaHere
4-JunClifford ChanceClifford Chance advised the Russian Far East and Arctic Development Fund on a loan of RUB 5.7 billion (approximately USD 80 million) for the Amur hydrometallurgical plant, a subsidiary of Polymetal.RUB5.7billionRussiaHere
9-JunBaker Mckenzie; Bryan Cave Leighton PaisnerBryan Cave Leighton Paisner advised Kopy Goldfields AB on Russian matters related to its acquisition of authorized capital of the Russian gold mining company Amur Gold from HC Alliance Mining Group Ltd. and Lexor Group SA. Baker McKenzie advised the sellers.N/ARussiaHere
11-JunNoerrNoerr advised the Bauer Media Group on the sale of its interests in its Russian publishing companies to its current Russian management. The portfolio sold by BMG consists of interests in five Russian entities and around 90 magazines in total.N/ARussiaHere
15-JunHerbert Smith Freehills; White & CaseWhite & Case advised Russian online video streaming service IVI on financing it received from Alfa Bank. Herbert Smith Freehills advised Alfa Bank on the deal.N/ARussiaHere
23-JunDebevoiseDebevoise & Plimpton advised Sberbank on the acquisition of a 75% stake in 2GIS, an international digital maps and city guides company that provides "geo-information and hyperlocal services."N/ARussiaHere
23-JunDLA Piper; Herbert Smith FreehillsDLA Piper advised Veon Holdings B.V.on the RUB 100 billion refinancing of its facilities with Russia's Sberbank. Herbert Smith Freehills advised Sberbank.RUB100billionRussiaHere
29-JunHerbert Smith FreehillsHerbert Smith Freehills advised RusChemAlliance, a joint venture of Gazprom and RusGazDobycha, on the Baltic LNG integrated gas processing and LNG project.N/ARussiaHere
30-JunBryan Cave Leighton PaisnerBryan Cave Leighton Paisner advised Sberbank Investments LLC on the acquisition of a 50% interest in Mayak LLC and Prima LLC, which are implementing projects related to the construction of a five-star hotel and apartments in Moscow.N/ARussiaHere
1-JulAlrud; Morrison FoersterAlrud and Morrison Foerster advised Taisho Pharmaceuticals Co., Ltd on the purchase of UPSA SAS and the acquisition of the certain assets of Bristol-Myers Squibb Company and its affiliates.USD1.6billionRussia
7-JulLiniya PravaLiniya Prava assisted DNS Development with preparations for the first ever public-private partnership to build a school and kindergarten in the Primorsky Kraj territory of the Russian Far East.N/ARussiaHere
10-JulCMSCMS helped money transfer provider MoneyGram register as an operator of a foreign payment system with the Central Bank of the Russian Federation.N/ARussiaHere
15-JulCMSCMS Moscow successfully represented the interests of GE Healthcare in several court proceedings against the Russian healthcare regulatory authority Roszdravnadzor.N/ARussiaHere
20-JulEgorov Puginsky Afanasiev & PartnersEPAM advised the VIS Group on the refinancing of a public-private partnership involving the construction of 12 social infrastructure facilities in Yakutsk through the placing of secured social bonds worth over RUB 5.6 billion. The refinancing was arranged by BKS, Otkritie Bank, DOM.RF Bank, and Sovcombank.RUB5.6billionRussiaHere
23-JulDebevoise; Hogan LovellsDebevoise & Plimpton advised the NLMK Group on a EUR 600 million revolving credit facility, with an accordion option allowing it to increase the funding limit up to EUR 1 billion. Hogan Lovells advised coordinating mandated lead manager ING Bank N.V. and mandated lead arrangers Credit Agricole Corporate and Investment Bank, NATIXIS, SGBTCI, AO Raiffeisenbank, Bank of America Merrill Lynch International Designated Activity Company, Mizuho Bank, Ltd., Deutsche Bank AG, London Branch, Bank ICBC (JSC), UniCredit S.p.A., and Intesa Sanpaolo Bank Ireland Plc .EUR600millionRussiaHere
27-JulBryan Cave Leighton PaisnerBryan Cave Leighton Paisner helped the PSA Group obtain Russian antitrust clearance for its merger with Fiat Chrysler Automobiles.N/ARussiaHere
27-JulIvanyan & PartnersIvanyan & Partners represented the interests of the Russian Union of Railway Transport Operators and oil products transporter Transoil in antitrust proceedings against railway wheel manufacturer Vyksa Steel Works.N/ARussiaHere
1-AugAlrud; DLA PiperAlrud advised New Era Company LLC on the sale of its Vans retail business to VF International SAGL and VF CIS LLC. DLA Piper advised the buyers.N/ARussia
3-AugWhite & CaseWhite & Case advised the Moscow Exchange, Russia's largest securities exchange group, on its acquisition of a 17% stake in BierbaumPro AG and the right to acquire the rest from unidentified sellers.N/ARussiaHere
11-AugBaker Mckenzie; Semenov & PevznerBaker McKenzie advised audio streaming service Spotify on its launch in 13 new markets, giving it a presence in 92 markets worldwide. Semenov & Pevzner advised Spotify on intellectual property issues related to its launch in the Russian market, as well as in Ukraine, Belarus, Moldova, and Kazakhstan.N/ARussiaHere
12-AugWhite & CaseWhite & Case advised VTB Bank and a consortium of investors on the RUB 132 billion sale of a 55% stake in Tele2 Russia to Russia's Rostelecom, and on the acquisition of an approximately 29% stake in Rostelecom.RUB132billionRussiaHere
14-AugEgorov Puginsky Afanasiev & PartnersEgorov Puginsky Afanasiev & Partners successfully represented Finland's Fortum energy company before the Russian government's commission on foreign investments and before Russia's competition authority with regard to the company's acquisition of a majority stake in Germany's Uniper.N/ARussiaHere
20-AugDentonsThe St. Petersburg office of Dentons advised Power Machines on the reform of its intellectual property management system.N/ARussiaHere
21-AugEgorov Puginsky Afanasiev & PartnersEgorov Puginsky Afanasiev & Partners helped The Chatterjee Group and Rhone Capital obtain approval from the Federal Antimonopoly Service of Russia for their acquisition of Lummus Technology from McDermott International.N/ARussiaHere
21-AugEgorov Puginsky Afanasiev & Partners; Eversheds SutherlandEgorov Puginsky Afanasiev & Partners and Eversheds Sutherland successfully protected the patent rights of Bayer in appellate proceedings before the Intellectual Property Court in Russia.N/ARussiaHere
31-AugBGP LitigationBGP Litigation successfully represented Irina Zhivova against her ex-husband in a post-divorce process regarding challenges to agreements involving property, children, and alimony.N/ARussiaHere
1-SepAlrud; Tomashevskaya & PartnersAlrud advised Aram Davtyan on the acquisition by Up and Run LLC of 100% of A3 Sport LLC in return for a 20% share in the newly-merged Up and Run, which become a JV. Tomashevskaya & Partners advised Up and Run.N/ARussia
1-SepAlrud; Cooley; Morgan Lewis & Bockius; NautaDutilhAlrud, NautaDutilh, and Cooley advised Uber B.V. on the contribution by Yandex N.V. of its car-sharing business to MLU B.V. as well as in connection with Yandex's restructuring of its self-driving business. Morgan, Lewis & Bockius advised Yandex.N/ARussia
7-SepEgorov Puginsky Afanasiev & PartnersEgorov Puginsky Afanasiev & Partners advised DynaEnergetics on the sale of its Russian subsidiary.N/ARussiaHere
7-SepWhite & CaseWhite & Case advised Raiffeisenbank on a loan of up to USD 127 million to Rosvodokanal.USD127millionRussiaHere
8-SepEgorov Puginsky Afanasiev & PartnersEgorov Puginsky Afanasiev & Partners provided BNP Paribas Fortis Private Equity Belgium with a red flag analysis of contracts for the provision of freight forwarding and customs representative services and storage.N/ARussiaHere
8-SepEgorov Puginsky Afanasiev & PartnersEgorov Puginsky Afanasiev & Partners advised US-based Clemco International, a manufacturer of air-powered abrasive blasting equipment, on IP, corporate, customs, and regulatory matters in Russia.N/ARussiaHere
15-SepDebevoiseDebevoise & Plimpton advised longstanding client PJSC MMC Norilsk Nickel on its USD 500 million Eurobond offering.USD500millionRussiaHere
18-SepHogan LovellsHogan Lovells advised Netflix on its partnership with Russia's National Media Group.N/ARussiaHere
18-SepDLA PiperDLA Piper advised Sberbank Investments on a secured mezzanine loan to Russia's Nizhny Novgorod Region and Prosveshcheniye Group for the construction of a training and educational center.N/ARussiaHere
21-SepDebevoise; Rybalkin, Gortsunyan & PartnersRybalkin, Gortsunyan & Partners, working with Debevoise & Plimpton and Henry King QC as part of PJSC Tatneft's legal team, successfully defended the right of Russian lawyers to claim attorney-client privilege in English court proceedings.N/ARussiaHere
22-SepDLA PiperDLA Piper advised the ADG group on the acquisition of Russian cinema operator Modern.N/ARussiaHere
28-SepDLA PiperDLA Piper advised VNV Global on its approximately USD 2 million investment in NaPopravku.N/ARussiaHere
30-SepEgorov Puginsky Afanasiev & PartnersEgorov, Puginsky, Afanasiev & Partners helped aluminum producer Rusal register as a new resident of the Special Administrative Region on Oktyabrsky Island in the Kaliningrad region of Russia.N/ARussiaHere
30-SepDLA PiperDLA Piper been appointed as a legal partner to provide pro bono legal assistance to the Russian Chapter: the Russian hub for the global platform on climate change that operates under the auspices of the World Economic Forum's Climate Governance Initiative.N/ARussiaHere
8-OctEversheds Sutherland; Tomashevskaya & PartnersEversheds Sutherland advised the Cherkizovo Group on its acquisition of Compas Foods LLC, a chicken processing facility in the Tula region of Russia that is a subsidiary of Cargill Inc. Tomashevskaya & Partners advised Cargill on the transaction.N/ARussiaHere
15-OctKachkin & PartnersKachkin & Partners helped Russian general contractor STEP LLC reach a settlement with Pharmasintez-Nord JSC in a dispute regarding payment for work and related claims.RUB100millionRussiaHere
16-OctHogan Lovells; White & CaseWhite & Case advised sole global coordinator and bookrunner Morgan Stanley & Co International on Mail.ru's US 200 million equity placing and further US 400 million convertible bonds offering due in 2025. Hogan Lovells provided legal advisory services to Mail.ru.USD600millionRussiaHere
20-OctBaker McKenzieBaker McKenzie advised PJSC Koks on the issuance of new Eurobonds by subsidiary IMH Capital and a cash tender offer together with an exit consent solicitation to the holders of USD 500 million notes due 2022 issued by Koks Finance, another subsidiary of PJSC Koks.USD350millionRussiaHere
27-OctEgorov Puginsky Afanasiev & PartnersEgorov Puginsky Afanasiev & Partners successfully defended Ilya Averyanov, the former owner of the Menshevik Confectionary in South-Eastern Moscow, against charges that he murdered a guard at the factory.N/ARussiaHere
27-OctAndrey Gorodissky & PartnersAndrey Gorodissky & Partners advised the founders of the "Kitchen in the District" service on their sale of an 87.4% stake in the company to O2O, a joint venture of the Mail.ru Group and Sberbank.N/ARussiaHere
30-OctEgorov Puginsky Afanasiev & Partners; Goodwin ProctorEgorov, Puginsky, Afanasiev & Partners, working alongside lead counsel Goodwin Procter, advised TA Associates on an unspecified investment in Netwrix Corporation.N/ARussiaHere
30-OctEgorov Puginsky Afanasiev & Partners; White & CaseWhite & Case advised global coordinator and bookrunner VTB Capital on PJSC Aeroflot's fundraising of more than USD 1 billion. Egorov Puginsky Afanasiev & Partners advised Aeroflot on the deal.RUB80billionRussiaHere
1-NovAlrud; Egorov Puginsky Afanasiev & PartnersAlrud advised indirect minority shareholders Elbrus Capital on the sale of 100% of Economy Development Center JSC to Teksa JSC. Egorov Puginsky Afanasiev & Partners advised the buyers.N/ARussia
1-NovAlrud; Shardul Amarchand Mangaldas & Co; Simpson Thacher & BartlettAlrud, Shardul Amarchand Mangaldas & Co, and Simpson Thacher & Barlett advised KKR on its acquisition of 54% stake in J.B. Chemicals & Pharmaceuticals Ltd.N/ARussia
3-NovLatham & Watkins; LinklatersLatham & Watkins advised arranger and lender VTB Bank in connection with the GBP 3 billion take-private offer for KAZ Minerals PLC made by Nova Resources, a consortium formed by two of KAZ Minerals' largest shareholders. Linklaters advised KAZ Minerals on the deal.GBP3billionRussiaHere
17-NovClifford Chance; DebevoiseClifford Chance advised BNP Paribas Personal Finance on the sale of its 20.8% stake in its Cetelem Bank joint venture to JV partner Sberbank. As a result of the deal, Sberbank, which was advised by Debevoise, became the sole shareholder of Cetelem Bank.N/ARussiaHere
18-NovKorelsky Ischuk AstafievKorelsky Ischuk Astafiev advised founders Philip Ilyin-Adaev, Kirill Ilin-Adaev, and Elena Ishcheeva on the sale of their stakes in Banki.ru to Elbrus Capital and another unspecified investment fund. Dentons advised the buyer on the deal.N/ARussiaHere
20-NovSemenov & PevznerSemenov & Pevzner successfully represented the interests of Domino's Pizza in the Russian city of Chelyabinsk in litigation against a former franchisee.N/ARussiaHere
26-NovEgorov Puginsky Afanasiev & PartnersEPAM successfully represented ZMK 1520 in a dispute with New Forwarding Company over the replacement supply of railway wagons.N/ARussiaHere
27-NovHogan LovellsHogan Lovells advised Digital Assets on its acquisition of Zvuk, a Russian independent music streaming service.N/ARussiaHere
1-DecAlrud; Slaughter and MayAlrud and Slaughter and May advised Trafigura on the acquisition of a 10% interest in Vostok Oil from Rosneft.N/ARussia
2-DecDebevoise; Latham & WatkinsLatham & Watkins advised the underwriters on the USD 1.1 billion initial public offering of Russian e-commerce platform Ozon Holdings PLC on Nasdaq. Debevoise & Plimpton advised Ozon Holdings on the deal.USD1.1billionRussiaHere
3-DecBryan Cave Leighton Paisner; DentonsBryan Cave Leighton Paisner advised Gazprom Neft PJSC on the creaion of Digital Industrial Platform, a joint venture with the Tsifra Group. Dentons advised the Tsifra Group on the deal.N/ARussiaHere
3-DecBryan Cave Leighton PaisnerBryan Cave Leighton Paisner advised the HeadHunter Group, which operates Russian online recruiting platform hh.ru, on the acquisition of the Zarplata.ru online recruiting platform from Hearst Shkulev Digital Regional Network B.V. The transaction, which is valued at RUB 3.5 billion, already been given the requisite regulatory approval and is expected to close in January 2021.RUB3.5billionRussiaHere
11-DecBryan Cave Leighton PaisnerBryan Cave Leighton Paisner advised Teva on the sale of a pharmaceutical company located in the Yaroslavl Industrial Park to Russia's R-Pharm Group.N/ARussiaHere
14-DecDLA PiperDLA Piper advised Sberbank Investments on its provision of a RUB 2 billion secured mezzanine loan to Russian construction company Avtoban to finance the construction of Startup Facilities No 3 and No 4 of the Central Ring Road in the Moscow Region.RUB2billionRussiaHere
18-DecAugust Debouzy; Houthoff Cooperatief; NoerrNoerr advised Axion Cyprus Holding Limited, a member of Russia's Softline Group, on its acquisition of a majority stake in Softline AG, a company listed on the open market segment of the Dusseldorf stock exchange, from its current major shareholder, Baden-Baden-based S.K. Management-und Beteiligungsgesellschaft mbH. Houthoff Cooperatief and August Debouzy also advised Axion on the deal.N/ARussiaHere
21-DecAkin Gump; LinklatersAkin Gump advised Equinor on its USD 550 million acquisition of a 49% stake in KrasGeoNaC from Rosneft. Linklaters's Moscow office advised the seller on the deal.USD550millionRussiaHere
22-DecBryan Cave Leighton PaisnerBryan Cave Leighton Paisner advised Gazpromneft-Snabzhenie on the establishment of the Iscource joint venture with Gazprombank.N/ARussiaHere
22-DecReveraRevera advised My.Games on its investments in Belarusian game development studios Mamboo Games, Appyfurious, and Purple Games.N/ARussiaHere
23-DecBryan Cave Leighton PaisnerBryan Cave Leighton Paisner advised the ESN Group on the design and construction of a methanol plant in the Amur Region in Russia.N/ARussiaHere
24-DecGowling WlgGowling WLG become a pro bono legal advisor to the Multimedia Art Museum in Moscow.N/ARussiaHere
24-DecOrrickOrrick advised JSC Sukhoi Civil Aircraft on its USD 1 billion sale, lease, and financing of a fleet of 31 Sukhoi Superjet 100 aircrafts to Ireland's CityJet.USD1billionRussiaHere
28-DecDLA Piper; Rybalkin, Gortsunyan & PartnersRybalkin Gortsunyan Partners advised the shareholders of Uchi.ru on the sale of a 25% stake in the educational platform, with an option of an increase to a controlling interest, to the Mail.ru Group and a consortium of investors formed by the Russian Direct Investment Fund and Russia-China Investment Fund. DLA Piper advised the buyers.RUB3.75billionRussiaHere
29-DecDentonsDentons advised the Zyfra Group on its establishment of a joint venture with Gazprom Neft PJSC.N/ARussiaHere
1-MayAlrud; Nagashima Ohno & TsunematsuAlrud and Nagashima Ohno & Tsunematsu advised Komatsu Ltd. on its acquisition of a majority stake in BOT Leasing Eurasia.N/ARussia
1-DecAkol Law FirmThe Akol Law Firm assisted VTB with suretyships granted by Ronesans Insaat for non-cash loans extended to Ronesans Construction JSC amounting to approximately RUB 70 billion.RUB70billionRussia, Turkey
1-DecAkol Law FirmThe Akol Law Firm assisted Sberbank with the facility agreements and surety agreements for loans granted to Yamata Endustriyel and Yamata Yatirim forĂŠ projects in Russia amounting to approximately EUR 200 million and RUB 2 billion.EUR200millionandRUB2billionRussia; Turkey
14-DecDurukan+PartnersDurukan+Partners advised Sovcombank PJSC on the USD 300 million financing to Rosatom subsidiary Akkuyu Nukleer A.S. for the Akkuyu NPP construction project, the first-ever nuclear power plant to be built in Turkey.USD300millionRussia; Turkey
3-AugAlrud; Linklaters; Paul, Weiss, Rifkind, Wharton & Garrison; Slaughter and MayAlrud, Slaughter and May, and Paul, Weiss, Rifkind, Wharton & Garrison advised Elanco Animal Health Incorporated on its acquisition of 100% of Bayer's Animal Health Business. Linklaters advised Bayer.USD6.9billionRussia; Turkey; Ukraine
2-MarRedcliffe Partners; White & CaseRedcliffe Partners advised Takeda Pharmaceutical Company Limited on the sale of a portfolio of over-the-counter and prescription pharmaceutical assets to Acino. White & Case advised the seller.USD200millionRussia; Ukraine
27-OctWhite & CaseWorking pro bono, White & Case successfully represented a Crimean applicant in his request for asylum in the United States.N/ARussia; UkraineHere
14-JanBDK Advokati; Samardzic, Oreski & GrbovicBDK Advokati advised Biomin GmbH on the acquisition of Vinfeed doo, a Serbian distributor of animal nutrition products. The unidentified sellers were advised by Samardzic, Oreski, & Grbovic.N/ASerbiaHere
17-JanJankovic Popovic MiticJPM Jankovic Popovic Mitic provided legal support to Gastrans d.o.o., Serbia (a 100% subsidiary of a OAO Gazprom and Srbijagas joint venture) on the construction of Gazprom's 400 km long Turkish Stream gas pipeline through Serbia, which Srbijagas Director Dusan Bajatovic has recently declared complete.N/ASerbiaHere
30-JanCMSCMS advised Turkey's DenizBank and Ziraat Bank on a loan of approximately EUR 220 million granted to the Ministry of Construction, Transport, and Infrastructure of the Republic of Serbia for the design, construction, and/or reconstruction of the Novi Pazar-Tutin, Sremska Raca-Kuzmin, and Pozega-Kotroman sections of the motorway and a bridge over the River Sava.EUR220millionSerbiaHere
31-JanCMSCMS Belgrade advised BMTS Technology on the opening of a manufacturing plant in Serbia.EUR50millionSerbiaHere
6-FebAndric Law Office; BDK Advokati; DentonsBDK Advokati advised the shareholders of Serbian IT company Logo doo on the sale of a 60% stake to GetSwift. Dentons and Andric Law advised GetSwift on the deal.N/ASerbiaHere
17-FebKaranovic & PartnersKaranovic & Partners advised Sweden's Backer AB on the acquisition of shares in Serbia's Elektrotermija d.o.o.N/ASerbiaHere
1-MarHarrisonsHarrisons advised the EBRD on a senior loan to Banca Intesa ad Beograd.EUR15millionSerbia
2-MarZivkovic SamardzicZivkovic Samardzic advised Serbia's national commercial broadcaster B92, a subsidiary of the Kopernikus Corporation, on its transformation from a joint-stock company into a limited liability company.N/ASerbiaHere
4-MarZivkovic SamardzicZivkovic Samardzic advised Israeli company Sizmek Technologies Ltd. on Serbian aspects of Amazon's acquisition of Sizmek's ad serving and dynamic content optimization businesses.N/ASerbiaHere
9-MarNKO PartnersNKO Partners advised Mercata, a Serbian distributor of fast-moving consumer goods, on its merger with Veletabak, a Serbian tobacco and consumer goods distributor. Veletabak was advised by solo practitioner Zeljko Marovic.N/ASerbiaHere
23-MarSamardzic, Oreski & GrbovicSOG advised Tesla on the launch of its first fast-charging station in Serbia.N/ASerbiaHere
1-AprCMP Studio di Avvocati; Karanovic & PartnersKaranovic & Partners, working alongside Italian counsel CMP Studio di Avvocati, advised Gucci, a company incorporated in the Netherlands, on the acquisition of a 70% stake in Serbian shoe manufacturer F.lli Rossi Shoes doo.N/ASerbia
2-AprJSP Law; Samardzic, Oreski & GrbovicSamardzic, Oreski & Grbobic advised Serbian construction and infrastructure company Compact Industry on its EUR 8 million construction deal with Swiss lighting manufacturer Regent Lighting. JSP Legal advised Regent Lighting on the deal.EUR8millionSerbiaHere
6-AprCMSCMS, in cooperation with GFA Consulting Group, helped the EBRD prepare a tendering process for the Serbian City of Pirot for the selection of a private partner in a PPP project titled "Reconstruction and Maintenance of the Public Lighting System in the City of Pirot."N/ASerbiaHere
15-AprJPM Jankovic Popovic MiticJPM advised the German School Belgrade on its implementation of a GDPR program.N/ASerbiaHere
28-AprDLA Piper; HarrisonsHarrisons, working with DLA Piper as the global advisor, represented ALD S.A. and Mitsubishi UFJ Lease & Finance Company Limited before the Commission for Protection of Competition of the Republic of Serbia in its attempt to obtain approval for the concentration which will occur as a result of its creation of a joint venture in Malaysia with MUL.N/ASerbia
25-MayBDK AdvokatiBDK Advokati has been appointed to act as the local representative for Google under the Serbian Data Protection Act.N/ASerbiaHere
26-MaySamardzic, Oreski & GrbovicSamardzic Oreski & Grbovic advised Bravos Holding on the acquisition of a high-class office building in Belgrade from DUTB.N/ASerbiaHere
26-MayNKO PartnersNKO Partners advised Dr. Max, the largest pharmacy network in Central Europe, on a public-private partnership project involving the concession of 27 state owned pharmacies located in the City of Krusevac and the Rasina District of Serbia.N/ASerbiaHere
27-MayKaranovic & Partners; NKO PartnersKaranovic & Partners advised Canadian precious and base metals exploration company Tethyan Resource Corp on its acquisition of ten percent of the shares and management control over the of the Serbian geological company EFPP. NKO Partners advised EFPP on the deal.N/ASerbiaHere
27-MayNKO PartnersNKO Partners advised industrial real estate developer CTP on its EUR 2.1 million acquisition of six hectares of land in Kragujevac, Serbia, from the City of Kragujevac.EUR2.1millionSerbiaHere
1-JunHarrisonsHarrisons acted as Serbian legal counsel to the EBRD on a loan to Eurobank ad Beograd under the COVID-19 Resilience Framework to be on-lent to eligible sub-borrowers.EUR40millionSerbia
1-JunHarrisonsHarrisons advised the EBRD in relation to a senior unsecured loan to ProCredit Bank Serbia ad Beograd. The loan shall be used for on-lending to eligible beneficiaries in Serbia.EUR40millionSerbia
1-JunHarrisonsHarrisons advised the EBRD in relation to senior loan to UniCredit Bank Serbia under the COVID-19 Resilience Framework.EUR75millionSerbia
3-JunKinstellarKinstellar advised Korea's Kyungshin Cable on the construction of a 12,000-square-meter factory in the Serbian town of Smederevska Palanka.EUR20millionSerbiaHere
3-JunNKO PartnersNKO Partners advised Lola Real Estate on its acquisition of 9,376 square meters of land in a public tender procedure from the Belgrade Land Agency, then advised Lola Real Estate sole shareholder Loran Soco on the sale of the company to the Czech Republic's UDI Group. Sole practitioner Aleksandra Nedeljkovic advised UDI on the latter deal.EUR7millionSerbiaHere
15-JunJPM Jankovic Popovic MiticJPM helped Gastrans d.o.o. Novi Sad draft the Natural Gas Transmission System Network Code, which, with the consent of the Energy Agency of the Republic of Serbia, entered into force on May 30, 2020.N/ASerbiaHere
16-JunKaranovic & PartnersKaranovic & Partners advised Serbian IT company 3Lateral on its EUR 7.7 million acquisition of a 6,500-square-meter lot from the City of Novi Sad.EUR7.7millionSerbiaHere
23-JunJPM Jankovic Popovic MiticJPM Jankovic Popovic Mitic advised sellers Milija Babovic and Apsara on the sale of a 67% stake in the Victoria Group to the MK Group.N/ASerbiaHere
29-JunNKO PartnersNKO Partners helped Konica Minolta Serbia, a part of a Japanese multinational technology company, obtain a favorable judgment from the Administrative Court of Serbia, which annulled a fine previously levied against the company by the Serbian Competition Commission for allegedly entering into restrictive agreements.N/ASerbiaHere
1-JulFreshfields; Karanovic & PartnersKaranovic & Partners, working with international counsel Freshfields, advised Guangdong Wencan Die Casting Co. on its acquisition of Le Belier.N/ASerbia
1-JulHarrisons; Reed SmithHarrisons, working with lead counsel Reed Smith, advised the EBRD in relation to a loan to Coral SRB doo Beograd to finance the expansion of Shell-branded gas stations and implement energy efficiency and environmental solutions.EUR10millionSerbia
1-JulHarrisonsHarrisons acted as legal counsel to the EBRD in relation to two loans to Erste Bank Serbia for the purpose of making sub-loans in accordance with the SME Policy Statement.EUR60millionSerbia
2-JulZivkovic SamardzicZivkovic Samardzic achieved a victory in the Appellate Court in Belgrade for the Crime and Corruption Reporting Network (KRIK), a non-profit organization established to improve investigative journalism in Serbia.N/ASerbiaHere
3-JulCMS; Nko PartnersNKO Partners advised industrial real estate developer CTP on a EUR 16.5 million financing for its real estate projects in Serbia from Raiffeisen Bank Serbia. CMS advised Raiffeisen Bank on the transaction.EUR16.5millionSerbiaHere
6-JulBojovic Draskovic Popovic & PartnersBojovic Draskovic Popovic & Partners is advising PEPCO on its plans to enter the Serbian market.N/ASerbiaHere
6-JulClifford Chance; Harrisons; Stephenson HarwoodHarrisons represented Al Dahra and ADQ before the Commission for Protection of Competition of the Republic of Serbia in its application for approval for the concentration that will occur as a result of ADQ's acquisition of 50% of the share capital and voting rights of Al Dahra. Stephenson Harwood was the global adviser on competition matters to Al Dahra while Clifford Chance was the global adviser on competiton matters to ADQ.N/ASerbia
22-JulPR LegalPR Legal successfully defended the interests of coffee producer and manufacturer Strauss Adriatic in a dispute over the alleged infringement of the "C Kafa" trademark.EUR45000SerbiaHere
4-AugCMS; NKO PartnersNKO Partners advised CTP on financing of EUR 13.5 million from the EBRD for real estate project development in Serbia. CMS advised the EBRD on the transaction.EUR13.5millionSerbiaHere
7-AugBojovic Draskovic Popovic & Partners; JPM Jankovic Popovic MiticJankovic Popovic Mitic advised French multinational company C.D Holding Internationale SAS on its EUR 5 million acquisition of an additional stake in Emergo Sport d.o.o., the Serbian subsidiary of Fitpass Limited. Fitpass was advised by Bojovic, Draskovic, Popovic, and Partners.EUR5millionSerbiaHere
19-AugJankovic Popovic MiticJankovic Popovic Mitic helped sporting good retailer Intersport S Trgovina doo comply with the Serbian Data Protection Act.N/ASerbiaHere
21-AugNKO PartnersNKO Partners advised BizLink Holding on what the firm calls an intercompany restructuring that resulted in the company becoming the sole shareholders of its subsidiary, BizLink Serbia.N/ASerbiaHere
25-AugKaranovic & PartnersKaranovic & Partners provided its analysis of the Serbian railway freight transport market to the World Bank Group and the Serbian Competition Commission regarding. The firm's analysis was provided as part of the Program for Improving the Business Environment in Serbia.N/ASerbiaHere
26-AugBDK AdvokatiBDK Advokati advised the EBRD and the Enterprise Expansion Fund on a EUR 12 million secured credit facility loan to High Tech Engineering Center, a software developer and technology research and development service provider in Serbia.EUR12millionSerbiaHere
27-AugMikijelj Jankovic & BogdanovicMikijelj, Jankovic & Bogdanovic successfully represented the interests of Serbian TV hosts Zoran Kesic and Ivan Ivanovic before the Press Council of Serbia regarding an alleged violation of the Code of Ethics of Serbian Journalists by daily newspaper Telegraf and the news portal Republika.rs.N/ASerbiaHere
10-SepMikijelj Jankovic & BogdanovicMikijelj Jankovic & Bogdanovic advised the Belgrade-based Nelt Grupa on its acquisition of baby food brand Bebi from Atlantic Grupa.N/ASerbiaHere
14-SepCT Legal; Zivkovic SamardzicZivkovic Samardzic advised Manchester-based biotech firm APIS Assay Technologies Ltd on the Serbian aspects of its acquisition of BeoGenomics. CT Legal advised the unnamed seller of BeoGenomics on the deal.N/ASerbiaHere
22-OctFieldfisher; LMS Studio Legale; Prica & PartnersPrica & Partners as Serbian counsel and LMS Studio Legale Milano as Italian counsel have advised Ferrero on Serbian merger clearance aspects related to Ferrero's acquisition of Fox's Biscuits. Fieldfisher advised CTH Invest, a Belgian holding group associated with Ferrero Group, on the underlying acquisition.N/ASerbiaHere
3-NovNKO PartnersNKO Partners helped Belgrade Waterfront open the Galerija Belgrade shopping center byĂŠassistingĂŠBelgrade Waterfront in drafting and negotiating all lease agreements for the shopping mall, including those with anchor tenants.N/ASerbiaHere
3-NovHarrisonsHarrisons advised the EBRD on its EUR 20 million loan to Banca Intesa Beograd.EUR20millionSerbiaHere
5-NovHarrisonsHarrisons advised the EBRD on an EUR 25 million loan, which will be matched by Raiffeisen Banka Beograd, to Sojaprotein. AP Legal advised Raiffeisen Banka on the deal.EUR25millionSerbiaHere
11-NovKaranovic & PartnersKaranovic & Partners helped set-up Ventu.rs, the first Serbian crowd-investing platform.N/ASerbiaHere
13-NovSchoenherrSchoenherr advised Serbian holding company Delta Holding on its acquisition of Sava Centar from the City of Belgrade.N/ASerbia
16-NovJankovic Popovic MiticJankovic Popovic Mitic helped chemical company BASF implement GDPR best practices in Serbia.N/ASerbiaHere
20-NovBDK Advokati; Gernhandt & Danielsson Advokatbyra KB; Sunjka LawBDK Advokati, working alongside Sweden's Gernandt & Danielsson Advokatbyra KB, advised the Embracer Group AB on the acquisition of all issued shares of Mad Head Games d.o.o., a game development studio in Novi Sad, Serbia. Sunjka Law advised Mad Head Games shareholders Nenad Tomic, Uros Banjesevic, and Aleksa Todorovic on the deal.N/ASerbiaHere
26-NovZivkovic SamardzicZivkovic Samardzic was appointed the representative of SNAP Inc. under the Serbian Data Protection Act, following a decision by the Commissioner for Information of Public Importance and Personal Data Protection.N/ASerbiaHere
27-NovAndric Law Office; Dentons; SchoenherrDentons advised Umweltbank Aktiengessellschaft, GLS Gemeinschaftsbank EG, and two investment funds managed by Triodos Investment Management on the acquisition of a majority stake in Opportunity Banka a.d. Novi Sad from Opportunity Transformation Investments inc. Andric Law Office provided Serbian advice to the buyers, and Schoenherr advised Opportunity Transformation Investments.N/ASerbiaHere
1-DecZivkovic SamardzicZivkovic Samardzic was appointed the representative for Yandex LLC pursuant to the Serbian Data Protection Act, following a decision by the Commissioner for Information of Public Importance and Personal Data Protection of Serbia.N/ASerbiaHere
3-DecAndrejic & Partners; NKO PartnersNKO Partners advised CTP Invest on its acquisition of a part of Eyemaxx Real Estate's portfolio in Serbia. Andrejic & Partners advised the seller.N/ASerbia
3-DecHarrisonsHarrisons advised the EBRD on Serbian law matters related to a loan to Intesa Leasing doo Beograd.EUR10millionSerbia
15-DecBDK AdvokatiBDK Advokati advised Affidea Diagnostic B.V. on the sale of Affideal Special Hospital in Belgrade to Medigroup System.N/ASerbiaHere
16-DecCMS; Jankovic Popovic MiticJankovic Popovic Mitic advised BASF on the sale of its Construction Chemicals business in Serbia to an affiliate of private equity firm Lone Star.N/ASerbiaHere
22-DecNKO PartnersNKO Partners advised the BizLink Group on its EUR 3.5 million acquisition of a commercial property and production facilities in Prokuplje, Serbia, from Gama Investor Solutions. Attorney-at-law Aleksandar Kuljak advised the seller on the deal.EUR3.5millionSerbiaHere
23-DecSamardzic, Oreski & GrbovicSamardzic, Oreski, Grbovic been appointed AiCure's data protection representative in Serbia by the Commissioner for Information of Public Importance and Personal Data Protection.N/ASerbiaHere
25-DecBopa Bojanovic Partners; Markovic Vukotic Jovkojic; SchoenherrSchoenherr advised Oaktree Capital Management on its acquisition of Serbian edible oil business Victoriaoil from the Victoria Group. Bopa Bojanovic Partners and Markovic Vukotic Jovkojic advised the seller.N/ASerbia
31-DecKinstellarKinstellar advised Croatia's Arena Hospitality Group on the acquisition by its Serbian subsidiary of the 88 Rooms Hotel in Belgrade.EUR5.95millionSerbia
1-MayHarrisonsHarrisons advised the EBRD on a senior secured loan granted to Javno Gradsko Saobracajno Preduzece Novi Sad, a public transport company fully owned by the City of Novi Sad to finance the acquisition of 30 compressed natural gas buses.EUR7millionSerbia
1-JunHarrisonsHarrisons advised the EBRD on a senior loan granted to Sabac District Heating Company to finance the implementation of energy efficiency measures in up to 40 residential multi-storey buildings in the City of Sabac.EUR2.5millionSerbia
14-JanAllen & Overy; Stanek Verak & PartnersAllen & Overy advised Vseobecna Uverova Banka on the sale and leaseback of a real estate portfolio. Stanek Verak & Partners advised the buyer.N/ASlovakia
23-JanEY Law; NoerrNoerr advised NEI, an Indian bearings manufacturer and exporter, on its acquisition of international bearings producer Kinex Bearings and bearing trading company Global Supply. The sellers were advised by Ernst & Young.N/ASlovakiaHere
24-JanCMS; MCLMCL advised MiddleCap Real Estate Ltd. on its acquisition, reconstruction, and development of the Gorkeho 4 office project and subsequently on the sale of the project to Kooperativa Insurance company, a member of the Vienna Insurance Group. Kooperativa Insurance was advised by CMS.N/ASlovakiaHere
5-MarKinstellarKinstellar advised Hungary-based financial group OTP Bank on the sale of its 99.44% stake in its Slovak operations to Belgium's KBC Group.N/ASlovakiaHere
11-MarKinstellar; Skubla & PartneriKinstellar advised Austrian company European City Estates on its acquisition of the Rosum office complex in Bratislava from Penta Real Estate, which was advised by Skubla & Partneri.N/ASlovakiaHere
11-MarHavel & Partners; SchoenherrHavel & Partners advised GTH Catering a.s., a company in the portfolio of the Genesis Capital fund, on its entry to the Slovak market and on its acquisition of Sodexo s.r.o., the Slovak subsidiary of French group Sodexo. Schoenherr advised the seller.N/ASlovakia
24-MarCechova Partners; Chiomenti; Nctm Studio LegaleCechova Partners, working with Chiomenti, advised on the acquisition of part of the Noovle group, including the indirect acquisition of Noovle Slovakia. Nctm Studio Legale advised the sellersN/ASlovakia
31-MarPRK PartnersPRK Partners advised co-lead managers J&T Banka (which also acted as arranger), Ceska Sporitelna, Komercni Banka, and UniCredit Bank Czech Republic and Slovakia on the preparation of the base prospectus and other documentation for a senior secured bonds issuance by EPH Financing.CZK7.5billionSlovakia
17-AprDentons; Majernik & MihalikovaMajernik & Mihalikova advised Livedispatcher and its founders on the sale of their entire shareholding to REEF Technologies. The buyers were advised by Dentons.N/ASlovakia
22-AprWhite & CaseWhite & Case advised lead managers Ceskoslovenska Obchodna Banka, Slovenska Sporitel'na, and Tatra Banka on the Slovak Republic's issuance of EUR 1.5 billion 1.000% notes due in 2030.EUR1.5billionSlovakiaHere
1-MayAllen & Overy; Capitol Legal GroupAllen & Overy represented ZSE Energia, a.s. in a dispute initiated by the European Institute for Consumer Protection regarding the manner of charging the "tariff for system operation" to electricity end consumers. Capitol Legal Group represented the EICP.N/ASlovakia
13-MayMajernik & MihalikovaMajernik & Mihalikova advised Proer, which is developing a solution for testing air quality, and its founders, on an investment received from the Crowdberry fund.N/ASlovakia
28-MayWhite & CaseWhite & Case advised lead managers Barclays Bank, Citigroup Global Markets Limited, Deutsche Bank AG, HSBC, and Intesa Sanpaolo Group member Vseobecna Uverova Banka on the Slovak Republic's dual tranche issuance of EUR 2 billion 0.250% notes due 2025 and EUR 2 billion 1.000% notes due 2032.EUR4billionSlovakiaHere
10-JunBohm & Partners; Havel & PartnersHavel & Partners advised Deutsche Telekom group member Slovak Telekom a.s. on the sale of Zoznam s.r.o. Bohm & Partners advised the buyer.N/ASlovakia
15-JunBartosik Svaby; Majernik & MihalikovaMajernik & Mihalikova advised Groupsolver, on raising of capital in Slovakia. Bartosik Svaby advised investor Eterus Capital..N/ASlovakia
9-JulBartosik SvabyBartosik Svaby advised the Eterus Capital fund on its EUR 1.5 million acquisition of a 12.36% stake in Eyerim.EUR1.5millionSlovakiaHere
22-SepFreshfields; KinstellarKinstellar advised E.ON on its acquisition of a 49% stake in electric utility Vychodoslovenska Energetika Holding from the German's RWE. Freshfields Bruckhaus Deringer advised the seller on the deal.N/ASlovakiaHere
29-OctMajernik & MihalikovaMajernik & Mihalikova advised Powerex, a company developing smart grid solutions, and its founder, on an investment into the company by Manifesto.N/ASlovakia
30-OctDentons; RelevansDentons advised Vseobecna Uverova Banka and UniCredit Bank on a EUR 105 million loan to J&T Real Estate for the construction of the Eurovea Tower in Slovakia. Relevans advised the unidentified borrower on the deal.EUR105millionSlovakiaHere
6-NovDentonsDentons helped petitioners obtain three favorable rulings from the Constitutional Court of the Slovak Republic.N/ASlovakiaHere
17-NovHavel & PartnersHavel & Partners advised Vision Ventures on its investment in Slovakian start-up Eatster, which operates an online food order application.N/ASlovakiaHere
16-DecMajernik & MihalikovaMajernik & Mihalikova advised on the sale of shares in SEC Technologies, a fast-growing scale up developing laser based detectors of chemicals, between its shareholders.N/ASlovakia
14-JanRojs, Peljhan, Prelesnik & Partners; Selih & PartnersSelih & Partnerji advised Supernova on its EUR 220 million acquisition of seven shopping malls and five smaller shopping centers from Centrice Real Estate GmbH, a member of America's Lone Star fund. The sellers were advised by Rojs, Peljhan, Prelesnik & Partnerji.N/ASloveniaHere
26-FebLaw Firm Prodan Juric; Miro SenicaMiro Senica represented Petrol d.d. in its acquisition of 100% of electricity distributor E-3 d.o.o. from Elektro Primorska. The Law Firm Prodan Juric advised the seller.N/ASlovenia
23-MarODI LawODI Law advised Agromarket's local Slovenian entity on its acquisition of Semenarna Ljubljana from Dezelna Banka Slovenije.N/ASloveniaHere
3-AprJadek & Pensa; Kavcic Bracun & Partners; Wolf TheissJadek & Pensa advised Abanka on its acquisition by NKBM from the Republic of Slovenia. NKBM was advised by Wolf Theiss, while Kavcic, Bracun & Partners advised the seller.N/ASloveniaHere
22-AprLinklaters; ODI LawODI Law worked alongside lead counsel Linklaters in advising cryptocurrency software development and research company nCHAIN on its acquisition of CREA, a Slovenia-based software development firm.N/ASloveniaHere
30-JunMiro SenicaMiro Senica advised Heba investicije d.o.o. on its purchase of a vacant building plot intended for a shopping center, as well as on the construction agreement and building permit issuance.EUR916220Slovenia
9-JulODI LawODI Law advised Hranilnica Lon on a new issuance of shares.N/ASloveniaHere
20-SepN/AMiro Senica represented subcontractor IMP, d.d. in a dispute with the main contractor for the construction of the "Olympic Centre Koper" project, consisting of an Olympic swimming pool, football field, and other sports and administration facilities, involving the contractor's withholding payment of EUR 900,000 out of a total of EUR 2.2 million due to alleged defects.EUR900000Slovenia
1-OctCooley; Miro SenicaMiro Senica was engaged by American company Vertica Capital Partners to perform legal and tax due diligence of Slovenian IT company Bunnyway d.o.o. related to its intended acquisition of an 80% stake in Bunnyway, although the transaction did not go forward due to commercial issues. Cooley advised on US law.N/ASlovenia
30-DecClifford Chance; Poellath; SchoenherrSchoenherr and Poellath, working alongside Clifford Chance, advised Deutsche Private Equity on Slovenian matters related to its acquisition of a majority stake in Mehler Vario System, a Germany-based manufacturer of bulletproof vests and protective systems, from Munich-based industrial holding firm Armira. Shearman & Sterling advised the seller.EUR21millionSlovenia
Shearman & Sterling$ 0
1-JanTurkeyAkol Law Firm; Allen & Overy; LinklatersTheAkolLawFirmandLinklatersassistedTurkiyeSinaiKalkinmaBankasiA.S.witha144A/RegSplacementofUSD350millionsustainableEurobondswith5-yearmaturitywhichwasunderwrittenbyCitiINGStandardCharteredBNPParibasCommerzbankBankABCandSMBCNikko.ThejointleadmanagerswereadvisedbyAllen&Overy.USD 350 million
9-JanTurkeyPelister Atayilmaz Enkur; TabogluThePelisterAtayilmazEnkurLawOfficeadvisedtheHoshizakiCorporationonitsacquisitionof28.6%ofsharesinOztiryakilerMadeniEsyaSanayiveTicaretviaasharetransferfromtheOztiryakilerfamilyandthesubscriptionofnewsharesfollowingacapitalincreaseinOzti.TheOztiryakilerfamilywasadvisedbyTabogluAttorneysatLaw.N/AHere
15-JanTurkeyOzbek Attorney Partnership; TuruncTuruncadvisedBigChefsonitsacquisitionofTurkey'sNumNumcafe/restaurantchainfromtheIsGirisimprivateequityfundandChefMehmetGurs.ThesellerswereadvisedbytheOzbekLawFirm.N/AHere
4-FebTurkeyBezen & PartnersBezen&PartnerssuccessfullyrepresentedTurkishfootballplayerOmerKerimAliRizainadisputewiththeTurkishFootballFederationbeforeTheEuropeanCourtofHumanRights.N/AHere
4-FebTurkeyGibson, Dunn & Crutcher; Paksoy; Winston & StrawnPaksoyworkedalongsideglobalcounselWinston&StrawninadvisingDanfossA/SaDanishmanufacturerofheattransfersolutionsonitsacquisitionofEatonCorporation'shydraulicsbusiness.Gibson&DunnadvisedEatononthetransaction.USD 3.3 billionHere
21-FebTurkeyPaksoyPaskoyadvisedNovartisonthesaleofoneofSandozTurkey'smanufacturingfacilitiestoTurkishpharmaceuticalcompanyGenericaIlac.N/AHere
28-FebTurkeyBaker Mckenzie (Esin Attorney Partnership); Gide Loyrette Nouel (Ozdirekcan Dundar Senocak)GideLoyretteNoueladvisedGroupamaHoldingFilialesetParticipationsonthesaleandtransferofits10%stakeinTurkishinsurancecompanyGunesSigortaA.S.toTVFFinansalYatirimlarAnonimSirketiasubsidiaryoftheTurkeyWealthFund.BakerMcKenzieadvisedTVFonthetransaction.N/AHere
31-MarTurkeyGuden Law FirmTheGudenLawFirmadvisedTurkishpetroleumexporterBDYGroupYatirimA.S.onquestionsrelatedtotheimpactofthegrowingCOVID-19crisisontheircompany'smastersaleandpurchaseagreements.N/AHere
31-MarTurkeyAkol Law Firm; DLA PiperTheAkolLawFirmworkingwithDLAPiperadvisedbothsidesonTurkishmattersrelatedtoDanaher-GeneralElectric'sUSD21.4billionglobalsaleofBiopharma.N/A
1-AprTurkeyAkol Law Firm; Herbert Smith Freehills; White & CaseTheAkolLawFirmworkingwithHerbertSmithFreehillsassistedChevroninthedisposalofinterestsintheAzeriChiragandDeepWaterGunashlifieldandBaku-Tbilisi-CeyhanpipelinetoMOLHungarianOilandGasPublicLimitedCompany.White&CasewasglobaltransactioncounseltoMOL.USD 1.57 billion
24-AprTurkeyAksan; BTS & Partners; Kolcuoglu Demirkan Kocakli; TuruncTuruncadvisedELBAHRInsanKaynaklariEgitimveDanismanlikAnonimSirketi(doingbusinessas"Peoplise")anditsfoundingshareholdersontheacquisitionof86.7%ofthecompanyfromthemandRevoCapitaland500StartupsbyLOGO.YazilimSanayiveTicaretA.S.BTS&PartnersandAksanadvisedRevoCapitaland500StartupsrespectivelyandKolcuogluDemirkanKockaliadvisedLOGO.N/AHere
1-MayTurkeyAkol Law FirmTheAkolLawFirmassistedTarimKrediHoldingandits12groupcompanieswithaforcedinitialpublicoffering.N/A
5-MayTurkeyAllen & Overy; Turunc; Yuksel LegalTuruncadvisedYu-CeMedicalanditsshareholdersCengizBalcikandYumnuBalcikontheacquisitionoftheremaining28%ofYu-CesharesfromtheAnatoliaGrowthCapitalFund.YukselLegalandAllen&OveryadvisedtheAnatoliaGrowthCapitalFundonthedeal.N/AHere
12-MayTurkeyLinklaters; PaksoyPaksoyandLinklatersadvisedISquaredCapitalLLPonitsindirectacquisitionof45%ofthesharesinRubisTerminal.N/AHere
2-JunTurkeyBTS & Partners; Ilhanli BaserBTS&PartnersadvisedTurkishlogisticscompanyYoldaanditsfoundersontheirreceiptofaninvestmentofUSD835000fromCollectiveSparkaninvestmentfundfocusingontechcompaniesandvariousangelinvestors.IlhanliBaseradvisedCollectiveSparkontheinvestment.USD 835,000Here
3-JunTurkeyAbcoo; Baker Mckenzie; Baker Mckenzie (Esin Attorney Partnership); BTS & Partners; Dentons; Dentons (Baseak); GKC Partners; Verdi Law Firm; White & CaseWhite&CaseanditsassociatedTurkishfirmGKCPartnersadvisedinteractiveentertainmentcompanyZyngaInc.onitsUSD1.8billionacquisitionofIstanbul-basedPeakOyunYazilimvePazarlamaA.S.BakerMcKenzieworkingwithitsTurkishaffiliatetheEsinAttorneyPartnershipadvisedPeakonthetransaction.DentonsalongwithitsaffiliateBalciogluSelcukArdiyokKekiAvukatlikOrtakligiadvisedHummingbirdVenturesCVAastheinvestorseller.BTS&PartnersadvisedEndeavourCatalystasaninvestorsellerandAbcoohadadvisedPeakFounderandCEOSidarSahin.USD 1.8 billionHere
10-JunTurkeyAllen & Overy; Gedik & EraksoyAllen&OveryandGedik&EraksoyadvisedStandardCharteredBankandBankofAmericaasarrangersofanESG-linkedsyndicatedloanfacilityforTurkey'sGarantiBBVA.N/AHere
15-JunTurkeyBTS & Partners; Norton Rose Fulbright; Norton Rose Fulbright (Inal Kama Attorney Partners)BTS&PartnersadvisedtheshareholdersofmobilepaymentandbanktransferserviceproviderPayguruonthesaleof100%ofitssharestoTpayMobile.NortonRoseFulbrightLondonandtheInalKamaAttorneyPartnershipadvisedTpayMobileonthedeal.N/AHere
26-JunTurkeyBTS & PartnersBTS&PartnersadvisedtheGrowthCircuitventurecapitalfirmonanunspecifiedinvestmentinInvidyo-adeveloperofchildmonitoringdevicesthatrelyonartificialintelligence.N/AHere
8-JulTurkeyBTS & Partners; Uysal Law FirmBTS&PartnersadvisedQNBeyondVenturestheventurearmofQNBFinansbankonanunspecifiedinvestmentincloud-basedaccountingsoftwareandfinancialapplicationplatformKolaybi.TheUysalLawFirmadvisedKolaybi'sshareholdersincludingitsfoundersandHUBVentureCapital.N/AHere
8-JulTurkeyCakmakCakmakadvisedLandesbankBaden-WurttembergandKfWIPEX-BankGmbHonthefinancingof132MWPhase2investmentinLodosKaraburunElektrikUretimA.S'swindfarmintheIzmirprovinceofTurkey.USD 134.5 millionHere
10-JulTurkeyCaliskan Okkan Toker; Travers Smith; TuruncTheTuruncLawFirmworkingalongsideTraversSmithrepresentedMicroFocusinitsacquisitionofAtarLabsfromfoundersBurakDayiogluMuratToraandGokhanSayandinvestorDiffusionCapitalPartners.ThesellerswererepresentedbyCaliskanOkkanToker.N/AHere
15-JulTurkeyAkol Law Firm; CMS (Yalcin Babalioglu Kemahli Attorney Partnership); Turunc; Yondem Yigit UclertopragiTheTuruncLawFirmadvisedagroupofprivateinvestorsledbyCetinYilmazontheiracquisitionofMCI'smajoritystakeinonlinetravelagencyTatilbudurfromPolishprivateequityfundMCI.TheYalcinBabaliogluKemahliAttorneyPartnershipadvisedMCIonthedealwhileAkolLawadvisedshareholderIsGirisim.TatilbudurwasadvisedbyYondemYigitUclertopragi.N/AHere
22-JulTurkeyCooley; Moroglu Arseven; Rajah & Tann; TuruncTuruncandCooleyadvisedUS-basedprivateequityfundRiverwoodCapitalonitsinvestmentinInsideragrowthmanagementplatformfordigitalmarketers.RiverwoodledtheUSD32millioninvestmentroundwhichincludedparticipationfromSequoiaWamdaandEndeavorCatalyst.MorogluArsevenandRajah&TannadvisedInsider.USD 32 millionHere
24-JulTurkeyAksanAksanadvisedPaketMutfakGayrimenkulIsletmeciligiveHizmetleriAnonimSirketianditsshareholdersonitslatestinvestmentround.N/AHere
24-JulTurkeyDentons; Dentons (BASEAK); Herguner Bilgen OzekeBalciogluSelcukAkmanKekiAttorneyPartnershipadvisedAnatoliaB.V.asubsidiaryofagriculturalexporterTiryakiAgroFoodsIndustryonthesaleof25.58%shareholdinginSunriseFoodsInternationalInc.toHassadHoldingsCanada.DentonsadvisedTiryakionEnglishlawmattersandHergunerBilgenOzekeadvisedHassadHoldings.N/AHere
24-JulTurkeyKinstellarKinstellaradvisedVivenseanditsCEOandfounderKemalErolonaUSD130millioninvestmentintothecompanybytheActeraGroupaprivateequityfirmfocusingoninvestmentsinTurkey.USD 130 millionHere
1-AugTurkeyAkol Law FirmTheAkolLawFirmassistedTSKBwiththeapproximatelyEUR17millionfinancingofthe9.8MWInegol-22.312MWOrduzuand2.4MWKapikayaBiogasPowerPlantProjectsrealizedbyDoguStar(adirectsubsidiaryofBiotrendandanindirectsubsidiaryofDoganlarYatirimHolding).EUR 17 million
1-AugTurkeyAkol Law FirmTheAkolLawFirmassistedTSKBwiththeapproximatelyEUR8millionfinancingofthe4.2MWBergamaBiogasPowerPlantProjectrealizedbyIzmirDoguStar(adirectsubsidiaryofBiotrendandanindirectsubsidiaryofDoganlarYatirimHolding).EUR 7 million
1-AugTurkeyAkol Law FirmTheAkolLawFirmassistedTSKBwiththeapproximatelyEUR3millionfinancingofthe2.4MWInegol-1BiogasPowerPlantProjectrealizedbyNovtekEnerji(adirectsubsidiaryofBiotrendandanindirectsubsidiaryofDoganlarYatirimHolding).EUR 3 million
1-AugTurkeyAkol Law FirmTheAkolLawFirmassistedTSKBwiththeapproximatelyEUR20millionfinancingoftheSimayWindPowerPlantprojectrealizedbySimayElektrik(ownedbyNoktaYatirimHoldingandYilsanYatirimHolding).USD 20 million
1-AugTurkeyAkol Law FirmTheAkolLawFirmassistedTSKBwiththeapproximatelyUSD7.5millionfinancingforDoganlarYatirimHolding'sacquisitionofMavenEnerjishares.USD 7.5 million
1-AugTurkeyAkol Law FirmTheAkolLawFirmassistedTSKBwiththeapproximatelyUSD3.5millionfinancingofthe2.8MWSivasBiogasPowerPlantProjectrealizedbyNovEnerji(adirectsubsidiaryofBiotrendandanindirectsubsidiaryofDoganlarYatirimHolding).USD 3.5 million
5-AugTurkeyAksanTurkey'sAksanLawFirmadvisedAlbarakaAssetManagementonitsinvestmentinClotieane-commercecompanythatprovidespersonalizedclothingservices.N/AHere
6-AugTurkeyBTS & PartnersBTS&PartnersadvisedTechOneVentureCapitalandTwozeroVenturesfundsmanagedbyActusAssetManagementonanunspecifiedinvestmentinFineDineDigitalMenusforRestaurantsCafes&Bars.N/AHere
11-AugTurkeyDentons; TOCC Attorney PartnershipTheTOCCAttorneyPartnershipadvisedAkbanksubsidiaryAKLeaseonitsEUR40millionfinancingfromtheEBRD.DentonsreportedlyadvisedtheEBRDonthedeal.EUR 40 millionHere
12-AugTurkeyCaliskan Okkan Toker; GKC Partners; White & CaseWhite&CaseanditsassociatedTurkishfirmGKCPartnersadvisedZyngaInc.onitsUSD168millionacquisitionofan80%stakeinRollicamobilegamesdeveloperandpublisherfromMehmetCanYavuzDenizBasaranBurakVardalVolkanBicerMehmetAyanandYunusEmreGonul.CaliskanOkkanTokeradvisedthesellersonthedeal.USD 168 millionHere
24-AugTurkeyAK Law Firm; Paksoy; SchulteriesenkampffPaksoyandGermany'sSchulteriesenkampfflawfirmadvisedImerysontheacquisitionbyitssubsidiaryCalderysDeutschlandGmbHofa60%stakeintheHaznedarGroupfromseveralindividualshareholders.TheAKLawFirmadvisedthesellersonthedeal.N/AHere
24-AugTurkeyBTS PartnersBTSPartnersadvisedQnbeyondventuresonanunspecifiedinvestmentinIkasasoftware-as-a-servicescommerceplatformforsmall-and-mediumenterprises.N/AHere
25-AugTurkeyGun & Partners; Moral & PartnersMoral&PartnersadvisedTaximCapitalonitsacquisitionofDoganayGidaaTurkishmanufacturerofnon-carbonatedbeveragessaucesandvinegars.Gun&Partnersadvisedtheunidentifiedsellers.N/AHere
28-AugTurkeyMoral & PartnersMoral&PartnersadvisedtheminorityshareholdersofTurquoiseYacht-formerlyknownasProteksan-onthesaleof40%ofthesharesofthecompanytotheAlBarwaniGroup.N/AHere
2-SepTurkeyAkol Law FirmTheAkolLawFirmadvisedCizmeciTimeontheacquisitonofaproductionandstoragefacility.N/A
4-SepTurkeyBTS & Partners; EY Legal (KS Attorney Partnership)BTS&PartnersadvisedthefoundersofEnteknoGlobalandDiffusionCapitalPartnersonCrodaInternationalPlc.'srecentGBP1.5millionacquisitionofaminoritystakeinthecompany.TheKSAttorneyPartnershipthelocallegalarmofEYTurkeyadvisedCrodaonthedeal.GBP 1.5 millionHere
8-SepTurkeyCakmak; PaksoyCakmakadvisedVoodooonanunspecifiedinvestmentinFabrikaGames.PaksoyadvisedFabrikaGamesonthedeal.N/AHere
14-SepTurkeyBezen & PartnersBezen&PartnersadvisedMBUAEInvestmentLLConitsbuy-outofminorityshareholdersinthecompany'sTurkishsubsidiaries.N/AHere
14-SepTurkeyAkol Law FirmTheAkolLawFirmadvisedGarantiBankonanapproximatelyEUR62millionfinancingfortheacquisitionofSesaAmbalajbyanindirectSPVofDoganHolding.EUR 62 million
14-SepTurkeyAkol Law Firm; Kolcuoglu Demirkan KocakliTheAkolLawFirmadvisedDoganHoldingsubsidiaryOncuGirisimSermayesiYatirimOrtakligia.s.onitsindirectacquisitionof70%ofSesaAmbalajvePlastikSanayiTicaretA.S.KolcuogluDemirkanKocakliadvisedthesellers.EUR 58 million
13-OctTurkeyErdem & ErdemErdem&ErdemadvisedtheSisecamGrouponitsacquisitionoffiveTurkishcompanies:AnadoluCamDenizliCamPasabahceSodaSanayiiandTrakyaCam.N/AHere
16-OctTurkeyHS Attorney PartnershipHSAttorneyPartnershipadvisedPoland'sSterSp.z.o.oonitsacquisitionof51%ofthesharesofFourceKoltukSistemlerifromshareholdersKorayUcarNedimGulerandTuncerCevik.N/AHere
21-OctTurkeyAkol Law Firm; Clyde & Co; Kolcuoglu Demirkan KocakliTheAkolLawFirmadvisedGlobalPortsHoldingPlconthesaleofa99.9%stakeinPortAkdenizacommercialportinAntalyatoQataricommercialportoperatingcompanyQTerminalsW.L.L.Clyde&CoandKolcuogluDemirkanKocakliadvisedthebuyer.USD 140 million
22-OctTurkeyPelister Atayilmaz Enkur; PwC LegalPelisterAtayilmazEnkuradvisedGreece'sEltonGroupontheacquisitionofthefinal20%ofTurkishchemicalresellersEltonMarmaraKimyaSanayiveTicaretAnonimSirketifromtheSenlenFamily.PwCLegaladvisedthesellers.N/AHere
23-OctTurkeyAllen & Overy; Aksu Caliskan Beygo Attorney Partnership; Durukan+Partners; Hogan Lovells; Gedik & Eraksoy; Latham & Watkins; Norton Rose FulbrightDurukan+PartnersadvisedEmaarPropertiesPJSCanditsTurkishsubsidiaryEmaarLibadiyeGayrimenkulGelistirmeA.S.ontheamendmentoftheUSD500millionloanfacilityextendedtothembyHSBCBankplcStandardCharteredBankandEmiratesNBDBankPJSCandonthecreationofeasementrightsandperfectionofnewmortgagesassecurityinterest.HoganLovellsandNortonRoseFulbrightadvisedtheborrowersonEnglishlaw.ThelenderswereadvisedbyLatham&WatkinsandAllen&OveryonEnglishlawandbyAksuCaliskanBeygoAttorneyPartnershipandGedik&EraksoyonTuskishLaw.USD 500 million
26-OctTurkeyKolcuoglu Demirkan Kocakli; SchoenherrSchoenherradvisedIstanbul-basedpaymentsoftwareproviderPaycoreonMediterraCapital'sacquisitionofamajoritystakeinthecompany.KolcuogluDemirkanKocakliadvisedthebuyer.N/A
26-OctTurkeyFreshfieldsFreshfieldsBruckhausDeringeradvisedtheEBRDSACEDEGIFCtheBlackSeaTradeandDevelopmentBankIntesaSanpaoloBaringsCreditAgricoleCIBDeutscheBankUniCreditAkbankIsbankandtheTurkishIndustrialDevelopmentBankontheEUR1.1billionrestructuringofthePPPagreementrelatedtothedevelopmentconstructionmaintenanceandoperationoftheAnkaraEtlikIntegratedHealthCampus.EUR 1.1 billionHere
5-NovTurkeyBASEAKTheBalciogluSelcukArdiyokKekiAttorneyPartnershipadvisedSabanciHoldingandthePPFGroupontheacquisitionbyeachofa50%stakeinTemsaUlasimAraclariSanayiveTicaretAnonimSirketi.N/AHere
6-NovTurkeyBaker Mckenzie; Esin Attorney Partnership; White & CaseBakerMcKenzieandTheEsinAttorneyPartnershipadvisedjointglobalcoordinatorsBankofAmericaandJ.P.MorganjointleadmanagerHSBCandco-managersRadobankandRenaissanceCapitalonUlkerBiskuviSanayi'sissuanceofUSD650millionEurobondsdue2025.White&Caseadvisedtheissueronthedeal.USD 650 millionHere
17-NovTurkeyKirkland & Ellis; Paksoy; Shearman & SterlingPaksoyandShearman&SterlingadvisedCanada'sTelusInternationalontheUSD935millionacquisitionofLionbridgeAI.Kirkland&EllisactedaslegaladvisortoLionbridgeAI.USD 935 millionHere
20-NovTurkeyCaliskan Okkan Toker; PaksoyPaksoyadvisedVolexonitsentranceintoaEUR61.8millionsharepurchaseagreementfortheacquisitionoftheentireissuedsharecapitalofDE-KAElektroteknikinTurkey.CaliskanOkkanTokeradvisedtheselleronthedeal.EUR 61.8 millionHere
1-DecTurkeyAkol Law Firm; Allen & Overy; Mayer BrownTheAkolLawFirmandMayerBrownassistedTurkiyeVakiflarBankasiT.A.O.withitsissuanceofUSD750million6.500%notesdue2026underitsUSD7billionGlobalMediumTermNoteProgramme.ThejointleadMmnagerswereadvisedbyAllen&Overy.USD 750 million
1-DecTurkeyAkol Law Firm; Baker McKenzie; Skadden, Arps, Slate, Meagher & FlomTheAkolLawFirmworkingwithglobaladvisorSkaddenArpsSlateMeagher&FlomadvisedCotyInconTurkishlawmattersrelatedtotheglobalsaleofCoty'sProfessionalandRetailHairbusinesstoKKR.BakerMcKenzieadvisedKKR.N/A
2-DecTurkeyCiftci; Clifford Chance; GKC Partners; White & CaseGKCPartnersandWhite&CaseadvisedtheQatarInvestmentAuthorityonitsacquisitionofa10%stakeintheBorsaIstanbulstockexchangefromtheTurkeyWealthFundwhichretainsan80.6%stake.CliffordChanceandtheCiftciLawFirmadvisedtheTurkeyWealthFundonthetransaction.N/AHere
3-DecTurkeyBener Law Office; PaksoyPaksoyadvisedchemicaldistributorIMCDonitsacquisitionoftheEjderKimyaIlacDanismanlikSanayiveTicaretpersonalcarebusinessfromPervinEjder.Beneradvisedthesellers.N/AHere
4-DecTurkeyAkol Law Firm; CakmakTheAkolLawFirmadvisedPalmetEnerjiA.S.onitsacquisitionoftheentiresharecapitalofBayminaEnerjiA.S.GazkoEnerjiTicaretA.S.(itselftheownerof90%ofthesharecapitalofIzgazIzmitGazDagitimSanayiveTicaretA.S.)andEngieYonetimEnerjiHizmetleriveTicaretA.S.Cakmakadvisedthesellers.N/A
14-DecTurkeyTOCC Attorney PartnershipTOCCAttorneyPartnershipadvisedAKLeasetheleasingsubsidiaryofTurkey'AKBankonaUSD25millionloanfromDutchentrepreneurialdevelopmentbankFMOforthefinancingofeligiblegreenprojectsinlinewithFMO'sGreenPrinciplesandCriteria.USD 25 millionHere
14-DecTurkeyAkol Law FirmAkolLawadvisedTurkishcandyproducerKervanGidaontheinitialpublicofferingofitssharesandtheirlistingontheIstanbulStockExchange.AkolLawalsoadvisedOyakYatirimwhichactedasthebrokeronthedeal.TL 465.7 millionHere
16-DecTurkeyKinstellar; Linklaters; PaksoyKinstellaradvisedTurkey'sDogusHoldingonthesaleofa30%stakeinIstanbul'sIstinyeParkshoppingmalltoDoha-basedinvestmenthouseQatarHoldingLLCwhichispartoftheQatarInvestmentAuthority.LinklatersandPaksoyadvisedQatarHoldingonthedeal.N/AHere
18-DecTurkeyCerrahoglu; Gleiss Lutz; SomayCerrahogluworkingalongsideleadcounselGleissLutzadvisedGelitaontheacquisitionofa65%stakeinSelJelJelatinSanayiveTicaretA.SviaGelitaInternationaleGelatineGmnHfromSelSanayiUrunleriTicaretvePazarlamaA.S.Somayadvisedthesellersonthedeal.N/AHere
21-DecTurkeyKolcuoglu Demirkan Kocakli; Moral & Partners; PaksoyMoral&PartnersadvisedminorityshareholderMuratCanErtozonthesaleofCigliSuTeknolojileriAnonimSirketitheholdingcompanyoftheVansanGroupCompaniestotheEbaraCorporation.MajorityshareholderAquamanB.V.asubsidiaryofTurkvenPrivateEquitywasadvisedbyKolcuogluDemirkanKocakli.PaksoyadvisedtheEbaraCorporation.N/A
22-DecTurkeyPaksoyPaksoyadvisedIstanbulMetropolitanMunicipalityonitsUSD580millionbondissuance.USD 580 millionHere
10-JanUkraineEversheds Sutherland; LCA Studio Legale; NoblesNoblesandItaly'sLCAStudioLegaleadvisedDreamgroupManagementanEasternEuropeanhosteloperatoronthesaleofitshostelsinWarsawPragueandBratislavatoLondon-basedhosteloperatorSafestayplc.EvershedsSutherlandadvisedSafestayonthetransaction.EUR 3.7 millionHere
13-JanUkraineEterna LawEternaLawhelpedBalticpowertraderAxtonCommoditieslaunchitsUkrainianoperationsandobtainapowertradingactivitieslicenseinUkraine.N/AHere
14-JanUkraineBaker Mckenzie; GestorsBakerMcKenzieandAttorneys'AssociationGestorsassistedArcelorMittalKryvyiRihinananti-dumpinginvestigationregardingtheimportsofcarbonandotheralloysteelrodsoriginatingfromBelarusandMoldova.N/AHere
14-JanUkraineAvellum; Latham & Watkins; Sayenko Kharenko; White & CaseSayenkoKharenkoandWhite&CaseadvisedtheJSCStateExport-ImportBankofUkraineontheissuanceofUSD100millionsubordinatedloanparticipationnoteslistedontheLondonStockExchange.Latham&WatkinsandreportedlyAvellumadvisedJ.P.MorganandMorganStanleythejointleadersonthetransaction.USD 300 millionHere
15-JanUkraineAstersAstersadvisedtheEBRDonaEUR10millionfinancingtotheKormotechGroup.EUR 10 millionHere
17-JanUkraineAsters; DeaconsAsterssuccessfullyrepresentedASKTechnologyLimitedaHongKong-basedmanufacturerofmulti-GPUsystemsforminingrenderingandAIinadisputewithaFinnishcompanyoveracontractforthesupplyofminingequipmentintheArbitrationInstituteoftheStockholmChamberofCommerce.DeaconsprovidedHongKong-lawexpertise.N/AHere
21-JanUkraineClifford Chance; Linklaters; Redcliffe PartnersRedcliffePartnersadvisedtheEBRDonUkrainianaspectsofitsloanofanadditionaltwomillioneurostoAquanovaDevelopmentLLCfortheconstructionequipmentandplacinginoperationofa3.5MWpsolarPVplantintheZakarpattyaRegionofUkraine.CliffordChanceandLinklatersadvisedtheEBRDonEnglishandItalianlawrespectively.N/AHere
21-JanUkraineAequo; Baker McKenzieAequoadvisedtheEpicentrGrouponitsreceiptofaUSD70millionmulti-currencysecuredloanfromtheBlackSeaTradeandDevelopmentBank.BakerMcKenzieadvisedBSTDBonthedeal.USD 70 millionHere
27-JanUkraineEterna LawEternaLawextendeditsagreementtoprovidelegalassistancetotheUkrainianTennisFederationforanotheryear.N/AHere
31-JanUkraineIlyashev & PartnersIlyashev&PartnershelpedDruzhkovkaHardwarePlantPrJSCinitiateananti-dumpinginvestigationintoimportsofsteelfastenersfromthePeople'sRepublicofChinaintoUkraine.N/AHere
31-JanUkraineSayenko KharenkoSayenkoKharenkoactedaslegalcounseltothewinnersofbothpilottendersfortheconcessionofUkraine'sKhersonandOlviaseaports.N/AHere
31-JanUkraineVasil Kisil & PartnersVasilKisil&PartnersadvisedLekhim-ObukhivLLContheacquisitionoftwolandplotsfromHelikomLVamanufacturerofwood-plasticcompositesintheUkrainiancommunityofObukhiv.N/AHere
1-FebUkraineAvellum; Harneys Aristodemou, Loizides, Yiolitis; LK Shields; Watson Farley & WilliamsAvellumactedastheUkrainianlegalcounseltotheEBRDinconnectionwithaEUR52.5millionloantoanOdessashoppingmall.TheEBRDwasalsoadvisedbyWatsonFarley&WilliamsonEnglishlawbyLKShieldsonIrishlawandHarneysAristodemouLoizidesYiolitisonCypriotlaw.EUR 52.5 million
3-FebUkraineIlyashev & PartnersActingonbehalfofHemoplastPJSCIlyashev&PartnerspersuadedUkraine'sInterdepartmentalInternationalTradeCommissiontoinitiateasafeguardinvestigationintosyringeimportsintoUkraine.N/AHere
6-FebUkraineIlyashev & PartnersIlyashev&PartnersisprovidingprobonoadvicetotheUkrainianRedCrossSocietyontheday-to-daybusinessactivitiesofitsorganizations.N/AHere
6-FebUkraineArzinger; Baker MckenzieBakerMcKenzieadvisedtheshareholdersofBiopharmaaUkrainianmanufacturerofpharmaceuticalsandhealthcareproductsonthesaleofitsnon-plasmabusinesstoStadaAG.ArzingeradvisedStadaonthedeal.N/AHere
6-FebUkraineAvellum; Latham & Watkins; Sayenko Kharenko; White & CaseSayenkoKharenkoandLatham&WatkinsadvisedBNPParibasJPMorganandRaiffeisenBankInternationalasthejointleadmanagersofUkraine'sEUR1.25billionEurobondissuance.AvellumandWhite&CaseadvisedUkraine'sMinistryofFinanceontheissuance.EUR 1.25 billionHere
7-FebUkraineEterna LawEternaLawadvisedBritishcompanySpacebitonitsattempttoperformthefirstBritishlandingonthemoon.USD 40 millionHere
11-FebUkraineIntegritesIntegritessuccessfullyprotectedtheinterestsofEuronetUkrainetheUkrainianrepresentativeoftheEuronetWorldwidegroupinataxdisputewiththeKyivStateFiscalService.UAH 64 millionHere
12-FebUkraineClyde & Co; KinstellarKinstellarincoordinationwithleadcounselClyde&CorepresentedQatariportoperatorQTerminalsinitssuccessfultenderfortheportconcessionprojectinvolvingtheBlackSeaPortofOlvia.USD 123 millionHere
13-FebUkraineRedcliffe PartnersRedcliffePartnershelpedGECapitalthefinancialservicesdivisionofGeneralElectricobtainclearancefromUkraine'scompetitionauthorityforitssaleofthePKAirFinanceaviationlendingbusinesstoApolloGlobalManagementandAtheneHoldingLtd.N/AHere
19-FebUkraineBaker MckenzieBakerMcKenzieadvisedtheBlackSeaTradeandDevelopmentBankonitsupUSD70millionloantoEpicentrKLLCandRenviorTradingLimited.USD 70 millionHere
20-FebUkraineMarchenko PartnersMarchenkoPartnersadvisedtheWesternNISEnterpriseFundonloansgrantedtoCCEDniproTrainingandProductionEnterpriseoftheUkrainianSocietyoftheBlindandthe"PrintingHouse"CenterforLaborRehabilitationofDisabledPersons.N/AHere
21-FebUkraineCMSCMSadvisedtheTISGrouponEnglishandUkrainianlawaspectsofajointventureinvolvingDPWorld'sentryintoUkraine.MarchenkoPartnersadvisedDPWorldonthedeal.N/AHere
24-FebUkraineKinstellarKinstellaradvisedDeutscheInvestitions-undEntwicklungsgesellschaftmbHadevelopmentfinanceinstitutionandsubsidiaryofKfWBankengruppeonaUSD20millioncreditfacilityforNibulonanagriculturalcommoditiesexporterandproducerinUkraine.CliffordChance'sFrankfurtofficeadvisedDEGonmattersofEnglishlaw.USD 20 millionHere
25-FebUkraineDLA PiperDLAPiperadvisedfoodchainBillaonaneight-yearleaseextensionwiththeKyivCityCouncilforBilla'sflagshipstoreinKyiv'sBessarabskyiMarket.N/AHere
26-FebUkraineRedcliffe PartnersRedcliffePartnersadvisedtheEBRDonariskparticipationagreementwithPiraeusBankUkrainewithatotalvalueofEUR10million.EUR 10 millionHere
26-FebUkraineEverlegalEverlegalsuccessfullyrepresentedTurkishairlineOnurAirinaclaimtorecoverUSD43million.USD 43 millionHere
27-FebUkraineVasil Kisil & PartnersVasilKisilandPartnerssuccessfullyrepresentedRostAgroaUkrainian-basedseedproducerandexporterinanadministrativeappealprocedurewiththeStateTaxServiceofUkraine.N/AHere
1-MarUkraineAvellum; OMPAvellumadvisedEpicentronitsacquisitionoftheSvarogGroup.OMPadvisedtheseller.N/A
1-MarUkraineAvellum; White & CaseAvellumandWhite&CaseadvisedtheUkrainianGovernmentonaloangrantedtoitbytheFrenchGovernmentfor30yearswitha10-yeargraceperiodandatarateof0.08%annualinterest.Theloanisdesignedhelpanunnamed"largeindustrialUkrainiancity"modernizeitswatersupplysystem.EUR 64 million
1-MarUkraineAvellum; Kinstellar; Watson Farley & WilliamsKinstellaradvisedWestSolarLLC-aprojectcompanyofSESSSolar-inconnectionwithfinancingbytheEBRD.AvellumandWatsonFarley&WilliamsadvisedtheEBRD.EUR 4.8 million
1-MarUkraineAvellum; Kinstellar; Watson Farley & WilliamsKinstellaradvisedSnyatinenergoinvestLLC-aprojectcompanyofSESSSolar-inconnectionwithfinancingbytheEBRD.AvellumandWatsonFarley&WilliamsadvisedtheEBRD.EUR 5.1 million
4-MarUkraineEterna LawEternaLawadvisedtheMETGrouponitsagreementtoassistUkrenergoonthelatter'splantoreconstructitsinfrastructureinUkraine.N/A
4-MarUkraineKinstellarKinstellarhelpedQatar-basedQTerminalsobtainmergercontrolapprovalfromtheAntimonopolyCommitteeofUkrainefortheappropriationofassetsbelongingtotheStateEnterprisesStevedoringCompanyOlviaandtheUkrainianSeaPortsAuthoritybothinMykolaivwhichenablestevedoringactivitiesintheSpecializedSeaPortOlvia.N/AHere
4-MarUkraineIlyashev & PartnersIlyashev&PartnerssuccessfullyprotectedtheinterestsofUkrainianmanufacturersandmembersoftheUkrainianAutoclavedAeratedConcreteProducersAssociationinananti-dumpinginvestigationrelatedtoimportsofgas-concreteblocksoriginatingintheRepublicofBelarus.N/AHere
5-MarUkraineEterna LawEternaLawadvisedtheUkrainiansubsidiaryofAIGonitsrestructuring.N/AHere
5-MarUkraineAvellum; DLA PiperAvellumadvisedarrangersJ.P.MorganSecuritiesPlcandRaiffeisenBankInternationalAGonaUSD464millionbridgeloanfinancingforBakcell'sacquisitionofPSJCVodafoneUkraine.DLAPiperadvisedBakcellonthedeal.USD 464 millionHere
6-MarUkraineCai & LenardCai&LenardisadvisingUkrainianteenagedancetroupeLightBalanceKidsonthenextphaseofwhatthefirmcallsits"creativedevelopment."N/AHere
9-MarUkraineSayenko KharenkoSayenkoKharenkoadvisedPromprylad.RenovationaprojectwithinthepremisesofarevitalizedSoviet-eraplantinIvano-Frankivskonitsbuying-outofplantfacilities.N/AHere
12-MarUkraineRedcliffe PartnersRedcliffePartnerssuccessfullyrepresentedUkrainianmobileoperatorLifecellĂŠinconnectionwithaninvestigationbytheAntimonopolyCommitteeofUkraineintotheuseof28-dayservicepackagesbymobileoperators.N/A
17-MarUkraineClifford Chance; Redcliffe PartnersRedcliffePartnersandCliffordChanceparticipatedinaglobalmappingsurveyfortheUnitedNationsSpecialRapporteurforHumanRightsandtheEnvironmentrelatedtotheexistence(ornon-existence)ofafundamentalhumanrighttoahealthyenvironment.N/AHere
17-MarUkraineRedcliffe PartnersRedcliffePartnersprovidedananalysisofUkrainianlaw(includingtaxlawandvariousstatutoryincentives)andotherjurisdictions'approachtosupportinggasextractionfromdepletedwellstotheUkrainianOilandGasAssociationandhelpedprepareaproposaltogovernmentalstakeholdersontaxincentivesthatUkrainecouldintroducetosupporttheuseofabandonedwellsandwellswithpoorconditions.N/A
19-MarUkraineEterna LawEternaLawsuccessfullyhelpedPZUZyciecompleteaninsurancecaseinvestigation.N/AHere
25-MarUkraineSayenko KharenkoSayenkoKharenkoadvisedOHHoldingLimitedonthesaleofa51%stakeintheLuxopticaGroupandthecreationofajointventurewithEssilorNederlandHoldingB.V.N/AHere
26-MarUkraineAvellumAvellumadvisedtheBlackSeaTradeandDevelopmentBankonalong-termsecuredloanofuptoUSD10milliontoButsefalLLCandPrometeySwissSA.USD 10 millionHere
27-MarUkraineSayenko KharenkoSayenkoKharenkoadvisedtheEBRDonitsprovisionofafour-yearloanofuptoEUR15milliontoOTPLeasing.TheloanwillbeavailablefordisbursementasUkrainianhrivnyasyntheticand/oreurodenominatedfacilities.EUR 15 millionHere
30-MarUkraineAstersAstersadvisedBritishoilandgascompanyRegalPetroleumonitsacquisitionofArkonaGas-EnergyaUkrainiancompanyholdingthelicensetoexploredevelopandproducehydrocarbonsintheSvystunkivsko-ChervonolutskefieldinthePoltavaregionofUkraine.USD 8.63 millionHere
31-MarUkraineAvellum; Watson Farley & WilliamsAvellumandWatsonFarley&WilliamsadvisedtheEBRDonalong-termsecuredloanofuptoEUR52.5milliontoNoviBiznesPoglyady.EUR 52.5 millionHere
1-AprUkraineEsquires Attorneys At LawUkraine'sEsquiresAttorneysatLawsuccessfullyrepresentedTradeandLogisticComplexArcticLLCinadisputeinvolvingtheunlawfultransferbyaformerdirectorofthecompanyofequipmentrelatedtothesupplyofelectricitytoacomplexofstorageandfoodproductionfacilitiestotheownershipofanothercompanythathewasaffiliatedwith.N/AHere
1-AprUkraineMarchenko PartnersMarchenkoPartnerscompletedrepresentationofNextPLCinlitigationandthenforcementofasettlementconnectedwithprotectingitstrademarkandcopyrightagainstalocalretailer.N/A
5-AprUkraineMarchenko PartnersMarchenkoPartnersrepresentedNextRetailandNextPLCinopposingbadfaithregistrationsoftrademarkssimilartoitsown.N/A
7-AprUkraineBird & BirdBird&BirdwonaUSD149millionjudgmentfromtheEnglishCommercialCourtforCarpatskyPetroleumCorporationasubsidiaryofKuwaitEnergyinadisputewithPJSCUkrnaftaarisingoutofajointactivityagreementrelatingtogasfieldsinUkraine.USD 149 millionHere
10-AprUkraineIntegritesIntegriteshelpedtheAgroGroupcompleteacompetitioninvestigationprojectinvolvingthesugarbeetprocessingmarketinitiatedbytheregionaldepartmentoftheAntimonopolyCommitteeofUkraineinthecountry'sChernihivregion.N/AHere
14-AprUkraineAvellumAvellumadvisedUkrainiandevelopmentcompanyUDPontheacquisitionofa33.35%stakeinOceanPlazaashoppingandentertainmentcenterinUkraine.N/AHere
14-AprUkraineIntegritesIntegritessuccessfullydefendedtheinterestsofrenewableenergyproducerEuroCapeUkraineinadisputeagainsttheHeadOfficeoftheStateTaxServiceinUkraine'sZaporizhzhiaregion.N/AHere
15-AprUkraineMarchenko PartnersMarchenkoPartnersadvisedBritishAirwaysontheappropriateprocedureforĂŠreducingstaffatitsrepresentativeoffices.N/A
21-AprUkraineCMS; Redcliffe PartnersRedcliffePartnersadvisedUkrGasVydobuvannyainconnectionwiththerehabilitationofoilandgasreservoirsthroughtheuseofaProductionEnhancementContractwithExpertPetroleum.CMSadvisedExpertPetroleum.USD 30 million
29-AprUkraineSayenko KharenkoSayenkoKharenkoadvisedtheEBRDonitsprovisionofanup-to-EUR7.5millionsyntheticloaninUkrainiancurrencytoBankLvivundertheEU4Business-EBRDCreditLine.EUR 7.5 millionHere
29-AprUkraineSayenko KharenkoSayenkoKharenkoadvisedtheEBRDonitsprovisionofafour-yearloanofuptoEUR15millionequivalenttoOTPLeasing.EUR 15 millionHere
30-AprUkraineBaker MckenzieTheKyivofficeofBakerMcKenzieassistedwithdraftingnewregulationsoftheNationalSecuritiesandStockMarketCommissionofUkrainefortheissuanceofUAH-denominatedbondsbyinternationalfinancialinstitutionsinUkraine.N/AHere
30-AprUkraineKPD ConsultingKPDadvisedWernerWirthonitsestablishmentofajointventurewithanunnamedUkrainianpartnerandonmakingacross-borderintra-grouploantothejointventure.N/AHere
4-MayUkraineCMSCMSadvisedtheBankofCyprusonUkrainianlawmattersfollowingits2014saleoftheUkrainiansubsidiaryofBankofCyprusandassociateddebttoAlfaGroupandontherefinancingbytheEBRDofaEUR68millionfacility.EUR 68 millionHere
7-MayUkraineMarchenko PartnersMarchenkoPartnershelpedCarlsbergUkraineconductacompetitioncompliancespotcheck.N/AHere
11-MayUkraineLCF Law GroupTheLCFLawGrouphelpedScatecSolarandPartnerslauncha54MWBoguslav-2PV-power-plantinUkraine.N/AHere
11-MayUkraineVasil Kisil & PartnersVasilKisilandPartnersadvisedIngersoll-RandonitsmergerwithGardnerDenver.N/AHere
12-MayUkraineEverlegalEverlegaladvisedUDPRenewablesonthedevelopmentandconstructionofthe20MWTerslavsolarpowerplantintheDnipropetrovskregionofUkraine.N/AHere
14-MayUkraineSayenko KharenkoSayenkoKharenkosuccessfullydefendedtheinterestsofpharmaceuticalmanufacturerBayerAGbeforetheSupremeCourtofUkraineregardingapatentdisputeoverthedrugRivaroxaban.N/AHere
14-MayUkraineVB PartnersVBPartnerssuccessfullyrepresentedtheinterestsofeducationalstart-upSkyEnginatrademarkregistrationproceedinginUkraine.N/AHere
18-MayUkraineLCF Law GroupUkraine'sLCFLawGroupbecamealegalpartneroftheUkrainianAssociationofRenewableEnergy.N/AHere
18-MayUkraineKinstellarKinstellaradvisedUMGInvestmentsontheacquisitionofaminoritystakeinFeednovaLLCaUkrainiancompanyfocusingontheproductionoffeedadditivesforfarmanimalsandpetsandthesubsequentestablishmentofajointventurewithEffectiveInvestmentsGroupandotherstakeholdersofFeednova.N/AHere
18-MayUkraineVasil Kisil & PartnersVasilKisilandPartnerssuccessfullyrepresentedtheinterestsofCzechnationalVasilSadochainacaseagainstUkrainebeforetheEuropeanCourtofHumanRights.N/AHere
21-MayUkraineAntikaUkraine'sAntikalawfirmsuccessfullydefendedtheinterestsofthePershainsurancecompanyinadisputeinvolvingtherecoveryoffundsbysubrogation.N/AHere
22-MayUkraineEsquires Attorneys At LawUkraine'sEsquireslawfirmsuccessfullydefendedtheinterestsofDiezelmashserviceKRLLCinthefirst-instanceDnipropetrovskDistrictAdministrativeCourtandthentheThirdAdministrativeCourtofAppealinaVATdisputewithUkraine'staxauthorities.USD 100,000Here
27-MayUkraineIntegritesIntegritesadvisedSibelcoontheacquisitionofUkrainianclayproducersEuromineralLLCandKurdyumovskyPlantPrJSC.Thesellerwasadvisedbyin-housecounselYanaPetrova.N/AHere
1-JunUkraineIlyashev & PartnersTheInternationalTradePracticeteamofIlyashev&Partnerssecuredtheintroductionofprovisionalanti-dumpingdutiesonimportstoUkraineofsteelfastenersoriginatinginthePeople'sRepublicofChina.N/AHere
3-JunUkraineAstersAstersadvisedtheEBRDonfinancingprovidedtoLantmannenAxaaproducerofbreakfastcerealsinUkrainethatisownedbySweden'sagribusinesscooperativeLantmannen.N/AHere
3-JunUkraineIlyashev & PartnersIlyashev&PartnerssuccessfullyprotectedtheinterestsofUkrainianMatchFactoryLLCinananti-dumpinginvestigationontheimportationofmatchesoriginatingintheRepublicofBelarusandtheRussianFederationintoUkraine.N/AHere
10-JunUkraineSayenko KharenkoSayenkoKharenkoadvisedDobrobutontheacquisitionoftheDoctorSammedicalnetworkwhichoperatesthreeclinicsinKyiv.N/AHere
11-JunUkraineAstersAsterssuccessfullydefendedPrivatBankCBJSCthelargestbankinUkrainebyassetsinadefamationdisputewithO.Dubilettheformerchairmanofthebank'sboardbeforetheCivilCourtofCassationoftheSupremeCourtinUkraine.N/AHere
11-JunUkraineSayenko KharenkoSayenkoKharenkoadvisedtheEBRDonitsup-to-USD60millionsecuredloantotheFozzyGroup.USD 60 millionHere
11-JunUkraineRedcliffe PartnersRedcliffePartnersadvisedCitibankUkraineonanup-toUSD30millionloantoMyronivskyHliboproduct.USD 30 million
17-JunUkraineSayenko KharenkoSayenkoKharenkosuccessfullyrepresentedtheinterestsofPJSCManufacturingAssociationStalkanat-SilurinasunsetreviewofantidumpingmeasuresagainsttheimportofwireropesoriginatingfromChinaintoUkraine.N/AHere
17-JunUkraineSayenko KharenkoSayenkoKharenkoadvisedJSCNovokramatorskyMachineBuildingPlantinasunsetreviewofanti-dumpingmeasuresagainsttheimportofcastingrollersoriginatingfromUkraineintotheEurasianEconomicUnion.N/AHere
19-JunUkraineAver LexAverLexpersuadedUkraine'scassationAdministrativeCourttoupholdthejudgmentsoflowercourtsthatthedismissalofUkraine'sSergeyBochkovskiyfromtheHeadoftheEmergencyServiceofUkrainewasunlawfulandgroundless.N/AHere
19-JunUkraineEsquires Attorneys At LawEsquiressuccessfullydefendedSolumLLCinadisputeoverrealestatepropertyrightsvaluedatUSD8.5million.USD 8.5 millionHere
22-JunUkraineIlyashev & PartnersIlyashev&PartnerspersuadedtheDistrictAdministrativeCourtofKyivtosuspendtheJune92020decisionoftheGeneralDirectorofUkroboronpromAivarasAbromaviciusdismissingOleksandrDonetsthepresidentoftheAntonovStateEnterprise.N/AHere
22-JunUkraineDechert; Redcliffe PartnersRedcliffePartnersandDechertadvisedScientificGamesCorporationonitsacquisitionofCome2Playacompanydevelopingnon-cashsocialgames.N/A
26-JunUkraineSayenko KharenkoSayenkoKharenkohelpedtheEBRDprepareitsinputintoUkraine'snewlawOnAmendmentstoCertainLegalActstoFacilitateAttractionofInvestmentsandtoIntroduceNewFinancialInstruments.N/AHere
1-JulUkraineMarchenko PartnersMarchenkoPartnersadvisedWesternNISEnterpriseFundonasecondloantoKyiv'sVeteranoPizzarestaurantwhichsupportsveteransofthemilitaryconflictintheEasternUkrainebyemployingthemandremitting10%ofitsprofitstofamiliesofdeceasedveterans.N/A
1-JulUkraineAstersAstersadvisedtheEBRDonaEUR25millionloantoYuria-PharmaUkrainianmanufacturerofintensivecaremedicinesmedicaldevicesandantiseptics.EUR 25 millionHere
3-JulUkraineDoubinsky & OsharovaDoubinsky&OsharovasuccessfullyrepresentedJackDanielbeforetheUkrainianSupremeCourtinatrademarkdispute.N/AHere
6-JulUkraineCMS; EverlegalEverlegaladvisedthefirstinnovationparkinUkraineUNIT.CityonitsreceiptofEUR50millioninfinancingfromtheEuropeanInvestmentBank.CMSadvisedEIBonthedeal.EUR 50 millionHere
7-JulUkraineAequoAequoadvisedDragonCapitalontheacquisitionofasix-storybuildinginKyiv.N/AHere
8-JulUkraineAstersadvisedtheEBRDonfinancingprovidedtotheGrainAllianceGroup.N/AHere
8-JulUkraineIlyashev & PartnersIlyashev&PartnerssuccessfullyrepresentedJSCorrugatingMachineryCo.Ltd.intheKyivCourtofAppealswhichupheldtherecognitionandenforcementinUkraineofChinaInternationalEconomicandTradeArbitrationCommission'sUSD5millionawardinfavorofthecompanyagainstLLCSouthCardboardUkrainepluspenaltiesandarbitrationfees.USD 5 millionHere
16-JulUkraineIlyashev & PartnersIlyashev&PartnersLawFirmsuccessfullydefendedtheinterestsofUkrainianpharmaceuticalmanufacturerBiopharmainacaseinvolvingtheprotectionofcompetitioninUkraine'simmunoglobulinsmarket.N/AHere
16-JulUkraineCMSCMSadvisedtheEBRDonaloanofapproximatelyUSD13.9milliontoUkraine'sIrshanskaSESLLC.USD 13.9 millionHere
21-JulUkraineBaker MckenzieBakerMcKenziesuccessfullydefendedtheinterestsofPrandicleLimited-acompanyownedbyformerUkrainianVicePrimeMinisterandformerNaftogazCEOOlehDubyna-againstproprietaryandunjustenrichmentclaims.N/AHere
22-JulUkraineAequoAequoadvisedAllriseCapitalInc.ontheacquisitionoftheChornomoretsstadiuminOdessafromImeksbank.ThesalewhichwasconductedbyauctionwasarrangedbytheDepositGuaranteeFund.N/AHere
22-JulUkraineAstersAstersadvisedtheIFConaUSD20millionloantoNyvaPereyaslavshchynyaUkrainianporkproducer.USD 20 millionHere
23-JulUkraineRedcliffe PartnersRedcliffePartnersadvisedtheEBRDonanuptoEUR25milliontermloantobeprovidedtoUkrainianStateAirTrafficServicesEnterpriseforworkingcapitalneeds.EUR 25 millionHere
24-JulUkraineVasil Kisil & PartnersVasilKisil&Partners'successfullyrepresentedMcDonald'sUkraineinacaseagainsttheUkrainianLeagueofCopyrightandRelatedRights.N/AHere
27-JulUkraineIntegritesIntegritesrepresentedMetroCash&CarryUkraineinadisputewithaformerenergysupplierwhofiledaclaimagainstoneofthecompany'sstoresdemandingthatitbefinedforchangingitselectricitysupplier.N/AHere
27-JulUkraineRedcliffe PartnersRedcliffePartnershelpedSaudiBasicIndustriesCorporationobtainmergerclearancefromtheUkrainiancompetitionauthorityfortheUSD69.1billionsaleof70%ofitssharesbythePublicInvestmentFundofSaudiArabia-thesovereignwealthfundoftheKingdomofSaudiArabia-totheSaudiArabianOilCompany.N/AHere
4-AugUkraineAvellum; Latham & Watkins; Sayenko Kharenko; White & CaseLatham&WatkinsandSayenkoKharenkoadvisedJPMorganandGoldmanSachsasthejointleadmanagersandjointdealer-managersonUkraine'ssuccessfulcompletionofthesettlementofitsnewUSD2billion7.253%Eurobonddue2033aswellasonitsfirst-everintra-dayswitchtenderofferinrelationtoitsoutstandingUSD-denominated7.75%seniornotesdue2021andUSS-denominated7.75%seniornotesdue2022.AvellumandWhite&CaseadvisedtheMinistryofFinanceofUkraine.EUR 2 billion
11-AugUkraineVasil Kisil & PartnersVasilKisil&PartnersadvisedStSophiaHomesonitsleaseofofficespaceinKyivtoGoethe-Institut.N/AHere
11-AugUkraineRedcliffe PartnersRedcliffePartnersadvisedtheEBRDonaUSD27millionshort-termsecuredloantoNibulonLLCaUkrainianagriculturalcompany.USD 27 millionHere
12-AugUkraineSayenko KharenkoSayenkoKharenkoadvisedtheEuropeanBankforReconstructionandDevelopmentonitsentryintothe1992ISDAMasterAgreementwiththeNationalBankofUkraine.N/AHere
19-AugUkraineBaker McKenzieBakerMcKenziesuccessfullyrepresentedBerlin-ChemieAG-themakeroftheNimesilanti-inflammatorydrug-initstrademarkchallengetotheNimesinbrand.N/AHere
19-AugUkraineCMS; Redcliffe PartnersRedcliffePartnersadvisedtheYayPayfinancialtechnologycompanyontheEUR17millionsaleofamajoritystakeinthecompanytoQuadient.ThebuyerwasadvisedbyCMS.EUR 17 millionHere
25-AugUkraineSayenko KharenkoSayenkoKharenkoadvisedOleksandrYaroslavskytheownerandpresidentoftheDCHgrouponhisacquisitionofallsharesofBankCreditDniprofromCyprianBrancroftEnterprisesLimited.N/AHere
26-AugUkraineEY Law; KinstellarKinstellaradvisedQatariportoperatorQterminalsanditsUkrainiansubsidiaryQterminalsOlviaontheirentranceintoa35-yearconcessionagreementfortheOlviaportwiththeMinistryofInfrastructureofUkraineandtheUkrainianSeaPortsAuthority.EYLawadvisedtheMinistryofInfrastructureandtheSeaPortsAuthorityonthedeal.EUR 122.9 millionHere
31-AugUkraineAstersAstersadvisedtheEBRDandIFConaUSD70millionloantoOJSCConcernGalnaftogazwhichoperatesachainofmorethan400fuelstationsinUkraine.USD 70 millionHere
31-AugUkraineGoLawGoLawactedasaleadcounselfortheCzechRepublic'sExportGuaranteeandInsuranceCorporationandGermany'sErsteAbwicklungsanstlatintheirUSD68milliondebtrestructuringincludingmotivatingdebtorsPJSCEurocarandLLCRICtorepaytheirloanstothecreditorsinanacceptableamount.USD 68 million
1-SepUkraineIlyashev & PartnersIlyashev&PartnerssuccessfullydefendedtheinterestsofDanubeShippingandStevedoringCompanyLLCinadisputewiththeUkrainianSeaPortsAuthorityovertheuseoftheberthandberthinginfrastructureattheMykolaivSeaPort.N/AHere
1-SepUkraineAvellum; White & CaseAvellumandWhite&CaseadvisedtheMinistryofFinanceofUkraineonaEUR250millionbilateralloanfromCargillFinancialServicesInternational.EUR 250 million
4-SepUkraineAvellum; White & CaseAvellumandWhite&CaseadvisedArgusMediaLtdonitsacquisitionofAgritelInternationalwhichprovidesinformationconsultingandforecastingonagriculturalandagro-industrialmarkets.N/AHere
7-SepUkraineClifford Chance; Homburger; Redcliffe PartnersRedcliffePartnersassistedSaudiArabianchemicalcompanySabidobtainmergerclearanceinUkraineforitsacquisitionofaminoritystakeintheClariantchemicalcompany.CliffordChancewasinternationalcounseltoSabicwhileHomburgerwasinternationalcounseltoClariant.N/A
8-SepUkraineAequoAequoadvisedRaiffeisenBankInternationalandCreativeDockonthelaunchofthe"Fairo"mobileapplication.N/AHere
8-SepUkraineAsters; IntegritesIntegritessuccessfullyprotectedtheinterestsofLifelongMeditechanIndianproducerandexporterofmedicalequipmentinasafeguardinvestigationinitiatedbytheUkrainianproducerHemoplastconcerningtheimportofsyringesinUkraine.AsterssuccessfullyrepresentedtheAssociationofMarketOperatorsofMedicalDevicesandotherUkrainianimportersduringtheinvestigation.N/AHere
8-SepUkraineBaker McKenzie; Sayenko KharenkoSayenkoKharenkoadvisedtheOreximGrouponthesaleofUkraine'sEveriportterminaltoRenaiscoB.V.asubsidiaryofGlencoreAgricultureLimited.BakerMcKenzieadvisedthebuyersonthedeal.N/AHere
9-SepUkraineSayenko KharenkoSayenkoKharenkoadvisedADMBungeCargillCOFCOtheLouisDreyfusCompanyandGlencoreAgricultureonobtainingclearancefromtheAnti-MonopolyCommitteeofUkrainefortheirestablishmentofajointventure.N/AHere
9-SepUkraineSayenko KharenkoSayenkoKharenkohelpedAbbVieInc.obtainmergerclearanceinUkrainefromthecountry'sAnti-MonopolyCommitteeforitsglobalUSD63billionacquisitionofAllerganplc.USD 63 billionHere
10-SepUkraineAvellumAvellumadvisedtheUkrainianMinistryofFinanceinconnectionwithanewmacro-financialassistanceprogramfromtheEuropeanUnion.EUR 1.2 billionHere
10-SepUkraineAvellum; Sayenko KharenkoSayenkoKharenkoadvisedJ.P.MorganonthepurchaseoftheUSD329millionEurobondtapissuebyUkraine.AvellumadvisedUkraine'sMinistryofFinance.USD 329 millionHere
15-SepUkraineIlyashev & PartnersIlyashev&PartnersinitiatedasafeguardinvestigationintotheimportofwirestoUkraineregardlessofthecountryoforiginandexportonbehalfofclientsPJSCOdesaCablePlantandPJSCYuzhkabelPlant.N/AHere
16-SepUkraineBaker MckenzieBakerMcKenzieconductedlegalduediligencefortheStatePropertyFundofUkrainerelatedtoitsprivatizationoftheDniproHotelwhichwassoldatauctionwithawinningbidofUAH1.111billion.UAH 1.111 billionHere
18-SepUkraineAstersAstersreachedasettlementfollowingananti-dumpinginvestigationconcerningimportsintoUkraineofhotrolledseamlesssteelpipesoriginatingfromthePeople'sRepublicofChina.N/AHere
21-SepUkraineIntegritesIntegritessuccessfullydefendedOrlenLietuvainadisputewiththeZhytomyrofficeoftheStateFiscalServiceofUkraine.UAH 1.5 millionHere
22-SepUkraineAequo; DentonsAequoadvisedNovusUkraineontheacquisitionoftheBillasupermarketchaininUkrainefromtheREWEGroup.Dentonsadvisedtheselleronthedeal.N/AHere
23-SepUkraineSayenko KharenkoSayenkoKharenkoanalyzeddataprotectionregimesintheUKGermanyCaliforniaIsraelandTurkeyaspartofatechnicalassistanceprojectsupportedbyUkraine'sMinistryofDigitalTransformationandtheUSAIDCompetitiveEconomyPrograminUkraine.N/AHere
24-SepUkraineIlyashev & PartnersIlyashev&PartnersisdefendingUkrainiantradeandeconomicinterestsinadisputebetweenUkraineandtheEUrelatingtoatemporaryexportbanonunprocessedtimber.N/AHere
24-SepUkraineRedcliffe PartnersRedcliffePartnersregisteredthecopyrightforlyricswrittenbyUkrainianmusicianStanislavZolotovthatwereplacedonYouTube.N/A
1-OctUkraineIlyashev & Partnerslyashev&PartnerssuccessfullydefendedtheinterestsofMunicipalEnterpriseInternationalAirportKyivandMaster-AviaLLCinadisputeinvolvingallegationsthattheyhadactedtogethertoimproperlyrestrictcompetitionintheKyivairport'sgroundhandlingmarket.N/AHere
6-OctUkraineEsquiresUkraine'sEsquireslawfirmhelpedSkytransLLCenforceagoodstransportationagreementithadwithanunidentifiedcustomer.USD 85,000Here
8-OctUkraineKinstellarKinstellarhelpedtheTurkeyWealthFundobtainmergercontrolapprovalfromtheAntimonopolyCommitteeofUkrainefortheacquisitionofacontrollinginterestinTurkcellIletisimHizmetleriA.S.N/AHere
8-OctUkraineArzingerArzingerassistedwithWaterEmpireUkraine'ssuccessfulappealofadecisionoftheAntimonopolyCommitteeofUkraineinvolvingthecompany'sallegedmarketviolations.UAH 2.7 millionHere
8-OctUkraineArzingerArzingeradvisedtheIFConaloantoOTPLeasinginUkraine.USD 50 millionHere
9-OctUkraineSayenko KharenkoSayenkoKharenkoadvisedthePowerConstructionCorporationofChinaLtd.onmattersrelatedtotheconstructionofthe245.7MWSyvashWindFarminUkraine.N/AHere
12-OctUkraineRedcliffe PartnersRedcliffePartnersadvisedUkrainianHRtechproductmanufacturerHurmaSystemonseedfinancingfromEuropeanventurecapitalfirmPragmatechVentures.N/AHere
13-OctUkraineVasil Kisil & PartnersVasilKisil&PartnerssuccessfullyrepresentedtheinterestsoftheReleconstructioncompanyinadisputewiththeKyivCityCounciloveritsfailuretorecognizeRele'stransferoftherighttouseland.N/AHere
13-OctUkraineDLA Piper; Sayenko KharenkoSayenkoKharenkoadvisedMyrwaytonHoldingLimitedonitssaleofanunspecifiedrailwayoperatortoRenaiscoasubsidiaryofGlencoreAgriculture.DLAPiperadvisedthebuyeronthedeal.N/AHere
20-OctUkraineAllen & Overy; Avellum; Linklaters; Sayenko KharenkoSayenkoKharenkoandLinklatershaveadvisedjointbookrunnersDeutscheBankNatixisIMIIntesaSanpaoloandRaiffeisenBankInternationalonMetinvest'sUSD333millionEurobondissue.Allen&OveryandAvellumadvisedMetinvest.EUR 333 millionHere
27-OctUkraineIntegritesIntegritessuccessfullyrepresentedtheinterestsofAKWUkrainianKaolinCompanybeforetheAntimonopolyCommitteeofUkraineregardinganallegedinfringementbytherailoperatorintheVinnytsiaregionofUkraine.N/AHere
27-OctUkraineCMSCMSadvisedINGBankN.V.onrestructuringthefinancingfacilityfortheViOilGrouptoreflectchangesinViOil'scorporatestructure.N/AHere
28-OctUkraineArzingerArzingerconvincedtheBoardoftheAppealsChamberofUkraine'sMinistryofEconomicDevelopmentTradeandAgriculturetorecognizethe"lifecell"trademarkaswell-knowninUkrainetherebyofficiallyconfirmingthe"highpositionofthelifecellbrand"inthetelecommunicationsservicesmarket.N/AHere
28-OctUkraineSayenko KharenkoSayenkoKharenkoadvisedElementumEnergyonitsacquisitionoftheminoritystakeinthejointventurecompanyEEhadenteredintowiththeVolterraEnergyGroup.N/AHere
30-OctUkraineAkin Gump; Allen & Overy; Asters; Clifford Chance; Redcliffe PartnersRedcliffePartnersandCliffordChanceadvisedED&FManTreasuryManagementplcthetreasurymanagementarmofED&FManaUK-basedinternationalcommoditiestraderonUkrainianlawaspectsontherefinancingandrestructuringofnearlyUSD1.5billionofdebtandraisinganextraUSD320millioninworkingcapital.Allen&OveryandAkinGumpStraussHauer&Feldadvisedtheschemecreditorsandnote-holdersrespectivelyandAstersadvisedtheunidentifiedlendersonUkrainianlawaspectsofthedeal.EUR 1.82 billionHere
2-NovUkraineHillmont PartnersHillmontPartnerssuccessfullydefendedtheinterestsofDeltaWilmarUkraineinadisputewiththeStateEnvironmentalInspectorateofUkraine.N/AHere
2-NovUkraineSayenko KharenkoSayenkoKharenkohelpedtheUkrainianParliamentformastrategytoobtainrecognitionfromtheEUCommissionthatUkraineprovidesadequateprotectionofpersonaldata.N/AHere
5-NovUkraineAstersAstershelpedtheTabletochkiFundorganizetheDobroRuncharityraceinvolvingover1200individualsfromUkraineand16othercountries.N/AHere
6-NovUkraineSayenko KharenkoSayenkoKharenkoadvisedWindFarmLLConitsentryintoanengineeringprocurementandconstructionagreementwithPowerchinaforthejointdevelopmentofan800megawattwindfarmintheDonetskregioninUkraine.N/AHere
6-NovUkraineIlyashev & PartnersIlyashev&PartnerssuccessfullyrepresentedChallengingShippingLtd.initsappealofadecisionoftheStateEcologicalInspectionofUkraineimposinganadministrativepenaltyontothecaptainofoneofitsshipsNewChallengeforcontaminatingtheharborwatersintheMykolayivseaport.UAH 13.5 millionHere
10-NovUkraineDLA PiperDLAPiperadvisedTechHostingLLContheleaseof7656squaremetersofofficespacetoserveasthecompany'snewco-workingspace.N/AHere
11-NovUkraineMarchenko PartnersMarchenkoPartnersadvisedtheWesternNISEnterpriseFundonaloantoWalnutHouseabakerybasedinLvivUkraine.N/AHere
11-NovUkraineIlyashev & PartnersIlyashev&PartnersworkingprobonoonbehalfoftheUkrainianRedCrossSocietypersuadedalargenetworkofmedicalcentersinUkrainetodiscontinueitsunauthorizeduseoftheRedCrossemblem.N/AHere
16-NovUkraineCMSCMShelpedthePrimoCollectGroupsecuretheapprovaloftheNationalBankofUkraineforitsacquisitionofasubstantialinterestintheKredyt-KapitalLLCfinancialinstitution.N/AHere
16-NovUkraineIntegritesIntegritessuccessfullydefendedtheinterestsofDominonianItalianmanufacturerofagriculturalmachineryinanunfaircompetitionclaimmadetotheAntimonopolyCommitteeofUkraine.N/AHere
19-NovUkraineAstersAstersadvisedtheEBRDonitsEUR3.3millionloantotheKormotechGroup.EUR 3.3 millionHere
20-NovUkraineEterna LawEternaLawhelpedtheWarChildhoodMuseumprojectopenamuseuminUkraine.N/AHere
23-NovUkraineAequoAequosuccessfullydefendedtherightsofUkraine'sDarnitsapharmaceuticalcompanytothesharesoftheBorshchahivskiychemical-pharmaceuticalplantintheSupremeCourtofUkraine.N/AHere
23-NovUkraineSayenko KharenkoSayenkoKharenkoadvisedtheEBRDonitsprovisionofaUSD100millionsecuredfinancingpackagetoNovus.EUR 100 millionHere
24-NovUkraineCMSCMSadvisedDiscoveryLifeSciencesaUS-basedbio-specimengenomicsequencingcellandimmunohistochemistryservicesfirmonitsacquisitionofEastWestBiopharmaaUkraine-basedhumanbio-specimensolutionsorganization.N/AHere
24-NovUkraineAstersAsterssuccessfullyrepresentedtheGlobusshoppingcenterinadisputewiththeUkrainiantaxauthority.UAH 300 millionHere
26-NovUkraineAstersAstersadvisedNaftogazEnergoserviceontheconstructionofa33megawattsolarpowerplantinChudnivUkraine.N/AHere
27-NovUkraineAntikaAntikaLawFirmsuccessfullyassistedUkrainianinsurancecompanyPershawithitsclaimforreimbursementoflegalfeesfromapreviousdispute.N/AHere
27-NovUkraineRedcliffe PartnersRedcliffePartnerssuccessfullyrepresentedLightConverseLtdinadisputeregardingthecancellationoftheLightconverseandLCtrademarksduetonon-use.N/A
27-NovUkraineAstersAsterssuccessfullydefendedPrivatBankCBJSCinadisputewiththeBukovelSkiResortheardbytheCommercialCourtofCassationoftheSupremeCourtofUkraine.UAH 7.5 billionHere
30-NovUkraineIlyashev & PartnersIlyashev&PartnerssuccessfullyprotectedtheinterestsofKarpatnaftochimLLCinasafeguardinvestigationregardingtheimportofpolymericmaterialstoUkraine.N/AHere
30-NovUkraineRedcliffe PartnersRedcliffePartnerssucessfullyrepresentedOntarioInc.beforethePatentOfficeofUkraineregardingthefilinganoppositiontoatrademarkapplication.N/A
30-NovUkraineSayenko KharenkoSayenkoKharenkosuccessfullyrepresentedtheinterestsoftheAuchanGroupinacaseinvolvingtheillegalalienationoflandplotsbelongingtoitintheOdessaregionofUkraine.EUR 10 millionHere
30-NovUkraineDentonsDentonsadvisedInnovatusCapitalPartnersonaUSD10millionpre-exportsecuredfacilitytoanunidentifiedgroupofcompaniesdealingwithproducingandtradingofgrainsoilseedsandbyproductsofoilseedsandotherfarmingservices.USD 10 millionHere
1-DecUkraineIlyashev & PartnersIlyashev&PartnersrepresentingtheinterestsofOBIOLLCpersuadedUkraine'sInterdepartmentalCommissiononInternationalTradetoinitiateananti-dumpinginvestigationoftheimportofheat-insulatingmaterialstoUkrainefromtheRepublicofBelarusandtheRussianFederation.N/AHere
1-DecUkraineEsquires Attorneys at LawEsquiressuccessfullyreversedtheseizureofimmovablepropertyonbehalfofEntertainmentCenterofSportahotelandentertainmentcomplexwithatotalareaofmorethan3.500squaremeterslocatedinthesuburbsofKyiv.N/AHere
1-DecUkraineAvellum; Latham & Watkins; Sayenko Kharenko; White & CaseAvellumandWhite&CaseadvisedtheMinistryofFinanceofUkraineonaUSD600milliontapissueofUkraine'soutstandingUSD2billion7.253%notesdue2033.Theadditionalissuancewaspricedata6.20%yield.SayenkoKharenkoandLatham&WatkinsadvisedjointleadmanagersBNPParibasandGoldmanSachsInternational.USD 600 million
1-DecUkraineAvellum; Clifford ChanceAvellumandCliffordChanceadvisedJointStockCompanyTheStateExport-ImportBankofUkraineandGoldmanSachsInternationalasdealermanageronTheStateExport-ImportBankofUkraine'sUSD316millioncashtenderoffer.USD 316 million
1-DecUkraineAvellum; Clifford Chance; Sayenko Kharenko; White & CaseAvellumandWhite&CaseadvisedtheMinistryofFinanceofUkraineonatermloanfacilityfromDeutscheBankAGtobeusedforgeneralbudgetarypurposestocovershort-termliquidityneeds.SayenkoKharenkoandCliffordChanceadvisedDeutscheBank.USD 350 million
1-DecUkraineAvellumAvellumactedasĂŠUkrainianlegalcounseltoBSTDBonitsprovisionofaEUR30millionloantoUkrgasbanktopromotefinancingforenvironmentallyfriendlyprojectsandtohelpUkrainiansmallandmedium-sizedenterprisesrecoverafterthepandemiccrisis.EUR 30 million
4-DecUkraineIlyashev & PartnersIlyashev&Partnerssuccessfullychallengedthearrestof50.3%ofthesharesofFerrexpoPoltavaMiningownedbyFerrexpoAGSwitzerland.N/AHere
4-DecUkraineAequoAequohelpedEstonia'sSupplierPlusGroupOUlaunchSupplierPlusasupplychainfinancesolutioninUkraine.N/AHere
9-DecUkraineAequo; KPMG LegalAequoadvisedDragonCapitalontheacquisitionofIndustrialParkRyasne-2fromEuropeanindustrialparkdeveloperCTP.KPMGUkraineadvisedCTPonthedeal.N/AHere
11-DecUkraineAstersAstersadvisedtheEBRDonitsissuanceofaloantoUkraine'sEnzymyeastmanufacturer.EUR 10 millionHere
11-DecUkraineEverlegal; IntegritesIntegritesadvisedJSBUkrgasbankonaEUR50milliondealwithUFuturetofinanceitsUNIT.CityprojectinUkraine.EverlegaladvisedUFutureonthedeal.EUR 50 millionHere
15-DecUkraineAvellumAvellumhelpedLVNLimitedobtainclearancefromtheAntimonopolyCommitteeofUkrainefortheprivatizationofapartoftheassetsofUkrspyrt-Ukraine'sstate-ownedproducerofalcoholandliquor.N/AHere
15-DecUkraineAsters; Bryan Cave Leighton Paisner; EverlegalEverlegaladvisedNovopecherskaSchoolonaEUR10millionloanagreementwiththeBlackSeaTradeandDevelopmentBankfortheconstructionofaschoolintheUNIT.Cityinnovationpark.BryanCaveLeightonPaisnerandAstersadvisedBSTDBonthedeal.EUR 10 millionHere
21-DecUkraineIlyashev & PartnersIlyashev&PartnerssuccessfullyrepresentedChina'sJ.S.CorrugatingMachineryCo.Ltd.initsrequestthatUkraine'sSupremeCourtenforceanarbitralawardissuedonitsbehalfbytheChinaInternationalEconomicandTradeArbitrationCommissionfortherecoveryofoverUSD5millionfromUkrainiandebtorSouthCardboardLLC.USD 5 millionHere
23-DecUkraineDoubinsky & OsharovaActingonbehalfofUkraine'sThreeBearsicecreamcompanyDoubinsky&OsharovapersuadedUkraine'sNorthernCommercialCourtofAppealtoupholdthedecisionoftheCommercialCourtofKyivthatthedesignation"KASHTAN"hadbecomecommonlyusedandthusqualifiedas"generic."N/AHere
23-DecUkraineSDM PartnersSDMPartnerssuccessfullyrepresentedtheinterestsofWrigleyUkraineinataxdisputevaluedatUAH28million.UAH 28 millionHere
24-DecUkraineAequoAequoadvisedOnitontheacquisitionofAxdraftaYCombinator-backeddocumentautomationcompany.N/AHere
24-DecUkraineDoubinsky & OsharovaDoubinsky&OsharovasuccessfullyrepresentedtheinterestsofJackDaniel'sinacassationappealmadebyStrongdrinkLLCtotheSupremeCourtofUkraine.N/AHere
24-DecUkraineArendt & Medernach; Avellum; Borel & Barby; Latham & Watkins; Linklaters; Sayenko KharenkoSayenkoKharenkoandLatham&WatkinsadvisedjointleadmanagersCreditAgricoleJ.P.MorganandNatixisontheUSD300million7-year6.75percentEurobondissuebyKernel.TheissuancewascoupledwithatenderoffertotheholdersofKernel'sexistingUSD500million5-year8.75percentEurobondduein2022.AvellumadvisedKernelonUkrainianaspectsoftheissuancewithLinklatersadvisingonmattersofEnglishandUSlawArendt&MedernachonLuxembourglawandBorel&BarbeyonSwisslaw.USD 300 millionHere
24-DecUkraineMarchenko PartnersMarchenkoPartnersadvisedEnergoGroupontherestructuringofitsapproximatelyUSD1billiondebtunderaPXFfacilitygrantedin2013byasyndicateconsistingamongothersofINGBankN.V.UniCreditBankAGVTBBankSAandRaiffeisenBankInternationalAG.USD 1 billion
29-DecUkraineAequoAequoadvisedtheEBRDonaUSD10millionloantoagribusinessoperatorAstarta.USD 10 millionHere
29-DecUkraineSayenko KharenkoSayenkoKharenkoadvisedtheEBRDonaEUR25millionfinancingtoOTPLeasingtosupportmicrosmallandmedium-sizedenterprisesinUkraine.EUR 25 millionHere
30-DecUkraineAequoAequosuccessfullydefendedtheintellectualpropertyrightsoftheDarnitsaPharmaceuticalcompanytotheCitramontrademarkinUkraine.N/AHere